PDB entry 5kbe

View 5kbe on RCSB PDB site
Description: crystal structure of the aromatic sensor domain of mopr in complex with phenol
Deposited on 2016-06-03, released 2016-07-13
The last revision was dated 2016-08-31, with a file datestamp of 2016-08-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MopR
    Species: Acinetobacter calcoaceticus [TaxId:471]
    Gene: mopR
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: MopR
    Species: Acinetobacter calcoaceticus [TaxId:471]
    Gene: mopR
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, IPH, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kbeA (A:)
    mspakdvkvykkileqnkdiqdlldkivfdaqhgqiwfdenrmllmhtsilgflrkdlyq
    mlglertkrffircgyqagmrdaevtsklrpnlneaeafmagpqmhgirgmvqvevnelh
    lshdlkqfyadfnwlnsfeaevhlsefgasdqpacwmllgyacgyssfvmgqtiiyqeth
    cvaqgdehcriigkplsewenadelirfmspdavsdeiialqaelnqlk
    

    Sequence, based on observed residues (ATOM records):
    >5kbeA (A:)
    eqnkdiqdlldkivfdaqhgqiwfdenrmllmhtsilgflrkdlyqmlglertkrffirc
    gyqagmrdaevtsklrpnlneaeafmagpqmhgirgmvqvevnelhlshdlkqfyadfnw
    lnsfeaevhlsefgasdqpacwmllgyacgyssfvmgqtiiyqethcvaqgdehcriigk
    plsewdavsdeiialqael
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kbeB (B:)
    mspakdvkvykkileqnkdiqdlldkivfdaqhgqiwfdenrmllmhtsilgflrkdlyq
    mlglertkrffircgyqagmrdaevtsklrpnlneaeafmagpqmhgirgmvqvevnelh
    lshdlkqfyadfnwlnsfeaevhlsefgasdqpacwmllgyacgyssfvmgqtiiyqeth
    cvaqgdehcriigkplsewenadelirfmspdavsdeiialqaelnqlk
    

    Sequence, based on observed residues (ATOM records):
    >5kbeB (B:)
    leqnkdiqdlldkivfdaqhgqiwfdenrmllmhtsilgflrkdlyqmlglertkrffir
    cgyqagmrdaevtsklrpnlneaeafmagpqmhgirgmvqvevnelhlshdlkqfyadfn
    wlnsfeaevhlsefgasdqpacwmllgyacgyssfvmgqtiiyqethcvaqgdehcriig
    kplsewenalirfmspdavsdeiial