PDB entry 5kb5

View 5kb5 on RCSB PDB site
Description: Crystal structure of the adenosine kinase from Mus musculus in complex with adenosine and adenosine-diphosphate
Class: transferase
Keywords: adenosine kinase, TRANSFERASE
Deposited on 2016-06-02, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Mus musculus [TaxId:10090]
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kb5a_
  • Heterogens: ADN, ADP, K, CL, MG, PG4, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kb5A (A:)
    mghhhhhhenlyfqghmasgslsenvlfgmgnplldisavvdkdfldkyslkpndqilae
    dkhkelfdelvkkfkveyhaggstqnsmkvaqwliqephkaatffgcigidkfgeilkrk
    aadahvdahyyeqneqptgtcaacitggnrslvanlaaancykkekhldlernwvlveka
    rvyyiagffltvspesvlkvaryaaennrvftlnlsapfisqffkealmdvmpyvdilfg
    neteaatfareqgfetkdikeiakkaqalpkvnskrqrtviftqgrddtivaaendvtaf
    pvldqnqeeiidtngagdafvggflsqlvsdkplteciraghyaasviirrtgctfpekp
    dfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kb5A (A:)
    lsenvlfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag
    gstqnsmkvaqwliqephkaatffgcigidkfgeilkrkaadahvdahyyeqneqptgtc
    aacitggnrslvanlaaancykkekhldlernwvlvekarvyyiagffltvspesvlkva
    ryaaennrvftlnlsapfisqffkealmdvmpyvdilfgneteaatfareqgfetkdike
    iakkaqalpkvnskrqrtviftqgrddtivaaendvtafpvldqnqeeiidtngagdafv
    ggflsqlvsdkplteciraghyaasviirrtgctfpekpdf