PDB entry 5kb3

View 5kb3 on RCSB PDB site
Description: 1.4 A resolution structure of Helicobacter Pylori MTAN in complexed with p-ClPh-DADMe-ImmA
Class: hydrolase
Keywords: Hydrolase, nucleosidase, helicobacter pylori, neutron crystallography
Deposited on 2016-06-02, released 2016-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminodeoxyfutalosine nucleosidase
    Species: Helicobacter pylori (strain J99 / ATCC 700824) [TaxId:85963]
    Gene: mtnN, mtn, jhp_0082
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZMY2 (1-229)
      • expression tag (0)
    Domains in SCOPe 2.07: d5kb3a1, d5kb3a2
  • Heterogens: 4CT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kb3A (A:)
    gqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstlt
    ttsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaif
    ietsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasva
    fvcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel