PDB entry 5kaw

View 5kaw on RCSB PDB site
Description: the structure of sav2435 bound to tetraphenylphosphonium and rhodamine 6g
Deposited on 2016-06-02, released 2016-08-24
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SA2223 protein
    Species: Staphylococcus aureus (strain N315) [TaxId:158879]
    Gene: SA2223
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0H3JRN6 (0-156)
      • expression tag (157-164)
  • Heterogens: RHQ, P4P, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5kawA (A:)
    meyqlqqlasltlvgiketyengrqaqqhiagfwqrcyqegviadlqlknngdlagilgl
    cipeldgkmsymiavtgdnsadiakydvitlasskymvfeaqgavpkavqqkmeevhhyi
    hqyqantvksapffelyqdgdttsekyiteiwmpvkglehhhhhh