PDB entry 5kaq

View 5kaq on RCSB PDB site
Description: crystal structure of broadly neutralizing influenza a antibody 31.a.83 in complex with hemagglutinin hong kong 1968.
Deposited on 2016-06-01, released 2017-02-22
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3.51 Å
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Hong Kong/1-4-MA21-1/1968(H3N2)) [TaxId:506380]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Hong Kong/1-4-MA21-1/1968(H3N2)) [TaxId:506380]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus (A/Hong Kong/1-4-MA21-1/1968(H3N2)) [TaxId:506380]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: antibody 31.a.83 fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAQ
  • Chain 'G':
    Compound: antibody 31.a.83 fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAQ (0-213)
  • Chain 'H':
    Compound: antibody 31.a.83 fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAQ (0-End)
  • Chain 'L':
    Compound: antibody 31.a.83 fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAQ (0-213)
  • Chain 'Q':
    Compound: antibody 31.a.83 fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAQ (0-End)
  • Chain 'R':
    Compound: antibody 31.a.83 fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAQ (0-213)
  • Heterogens: NAG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kaqA (A:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtrglfgaiagfiengwegmidgwygfrhqnseg
    tgqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidl
    wsynaellvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacies
    irngtydhdvyrdealnnrfqikgvsgrlvpr
    

    Sequence, based on observed residues (ATOM records):
    >5kaqA (A:)
    atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
    lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
    tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
    qtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvinsngn
    liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
    qntlklatgmrnvpekgfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingk
    lnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidlt
    dsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf
    q
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kaqB (B:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtrglfgaiagfiengwegmidgwygfrhqnseg
    tgqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidl
    wsynaellvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacies
    irngtydhdvyrdealnnrfqikgvsgrlvpr
    

    Sequence, based on observed residues (ATOM records):
    >5kaqB (B:)
    atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
    lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
    tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
    qtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvinsngn
    liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
    qntlklatgmrnvpekfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingkl
    nrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltd
    semnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kaqC (C:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtrglfgaiagfiengwegmidgwygfrhqnseg
    tgqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidl
    wsynaellvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacies
    irngtydhdvyrdealnnrfqikgvsgrlvpr
    

    Sequence, based on observed residues (ATOM records):
    >5kaqC (C:)
    atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
    lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
    tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
    qtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvinsngn
    liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
    qntlklatgmrnvpekagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqing
    klnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidl
    tdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnr
    fq
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5kaqF (F:)
    evqllesggglvqpgeslrvscaasgftfrdsalswvrqapgkglewvsaisgnggatyy
    adtvkgrftisrdnsqttlylqmnslraddtatyycakdesppiynlmpgyystyyymdv
    wgkgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdk
    

    Sequence, based on observed residues (ATOM records):
    >5kaqF (F:)
    vqllesggglvqpgeslrvscaasgftfrdsalswvrqapgkglewvsaisgnggatyya
    dtvkgrftisrdnsqttlylqmnslraddtatyycakdesppiynlmpgyystyyymdvw
    gkgttvtvssstkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh
    tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5kaqG (G:)
    eivmtqspvtlsvspgetatlscrasqsvrsnlawyqqkpgqaprlliygastratdipa
    rfsgsgsgteftlsisslqsddfavyycqqynhwlrtfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records):
    >5kaqG (G:)
    eivmtqspvtlsvspgetatlscrasqsvrsnlawyqqkpgqaprlliygastratdipa
    rfsgsgsgteftlsisslqsddfavyycqqynhwlrtfgqgtkleiktvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5kaqH (H:)
    evqllesggglvqpgeslrvscaasgftfrdsalswvrqapgkglewvsaisgnggatyy
    adtvkgrftisrdnsqttlylqmnslraddtatyycakdesppiynlmpgyystyyymdv
    wgkgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdk
    

    Sequence, based on observed residues (ATOM records):
    >5kaqH (H:)
    evqllesggglvqpgeslrvscaasgftfrdsalswvrqapgkglewvsaisgnggatyy
    adtvkgrftisrdnsqttlylqmnslraddtatyycakdesppiynlmpgyystyyymdv
    wgkgttvtvssstkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgv
    htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5kaqL (L:)
    eivmtqspvtlsvspgetatlscrasqsvrsnlawyqqkpgqaprlliygastratdipa
    rfsgsgsgteftlsisslqsddfavyycqqynhwlrtfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records):
    >5kaqL (L:)
    eivmtqspvtlsvspgetatlscrasqsvrsnlawyqqkpgqaprlliygastratdipa
    rfsgsgsgteftlsisslqsddfavyycqqynhwlrtfgqgtkleiktvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >5kaqQ (Q:)
    evqllesggglvqpgeslrvscaasgftfrdsalswvrqapgkglewvsaisgnggatyy
    adtvkgrftisrdnsqttlylqmnslraddtatyycakdesppiynlmpgyystyyymdv
    wgkgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsg
    vhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdk
    

    Sequence, based on observed residues (ATOM records):
    >5kaqQ (Q:)
    evqllesggglvqpgeslrvscaasgftfrdsalswvrqapgkglewvsaisgnggatyy
    adtvkgrftisrdnsqttlylqmnslraddtatyycakdesppiynlmpgyystyyymdv
    wgkgttvtvssstkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgv
    htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'R':
    Sequence, based on SEQRES records:
    >5kaqR (R:)
    eivmtqspvtlsvspgetatlscrasqsvrsnlawyqqkpgqaprlliygastratdipa
    rfsgsgsgteftlsisslqsddfavyycqqynhwlrtfgqgtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records):
    >5kaqR (R:)
    eivmtqspvtlsvspgetatlscrasqsvrsnlawyqqkpgqaprlliygastratdipa
    rfsgsgsgteftlsisslqsddfavyycqqynhwlrtfgqgtkleiktvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec