PDB entry 5kan

View 5kan on RCSB PDB site
Description: Crystal structure of multidonor HV1-18-class broadly neutralizing Influenza A antibody 16.g.07 in complex with A/Hong Kong/1-4-MA21-1/1968 (H3N2) Hemagglutinin
Class: immune system
Keywords: Influenza, multidonor, H5, universal influenza vaccine, IMMUNE SYSTEM
Deposited on 2016-06-01, released 2016-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-30, with a file datestamp of 2016-11-25.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-318)
      • conflict (210)
    Domains in SCOPe 2.07: d5kana_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kanb_
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-318)
      • conflict (210)
    Domains in SCOPe 2.07: d5kanc_
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kand_
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7 (0-318)
      • conflict (210)
    Domains in SCOPe 2.07: d5kane_
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kanf_
  • Chain 'G':
    Compound: 16.g.07 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAN (0-230)
  • Chain 'H':
    Compound: 16.g.07 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAN (0-230)
  • Chain 'I':
    Compound: 16.g.07 Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAN (0-213)
    Domains in SCOPe 2.07: d5kani1, d5kani2
  • Chain 'J':
    Compound: 16.g.07 Heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAN (0-230)
  • Chain 'K':
    Compound: 16.g.07 Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAN (0-213)
    Domains in SCOPe 2.07: d5kank1, d5kank2
  • Chain 'L':
    Compound: 16.g.07 Light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 5KAN (0-213)
    Domains in SCOPe 2.07: d5kanl1, d5kanl2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kanA (A:)
    nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli
    dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw
    tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpst
    nqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvins
    ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kanB (B:)
    gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
    hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr
    rqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kanC (C:)
    nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli
    dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw
    tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpst
    nqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvins
    ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpek
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kanD (D:)
    gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
    hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr
    rqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kanD (D:)
    gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
    hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr
    rqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kanE (E:)
    nstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctli
    dallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftw
    tgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpst
    nqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvins
    ngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpk
    yvkqntlklatgmrnvpek
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5kanF (F:)
    gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
    hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr
    rqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kanF (F:)
    gaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektnekf
    hqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfektr
    rqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kanI (I:)
    diqmtqvpvslsafvgdrvsitcrasqdisrwlawyqqkpgrapklliyaasslqggvps
    rfrgsgsgteftltisglqpedfatyycqqgstfpytsvlgtilgipgtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglrspvtksfnrgec
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kanK (K:)
    diqmtqvpvslsafvgdrvsitcrasqdisrwlawyqqkpgrapklliyaasslqggvps
    rfrgsgsgteftltisglqpedfatyycqqgstfpytsvlgtilgipgtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglrspvtksfnrgec
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kanL (L:)
    diqmtqvpvslsafvgdrvsitcrasqdisrwlawyqqkpgrapklliyaasslqggvps
    rfrgsgsgteftltisglqpedfatyycqqgstfpytsvlgtilgipgtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglrspvtksfnrgec