PDB entry 5kam

View 5kam on RCSB PDB site
Description: Trypanosome brucei Hypoxanthine-guanine phosphoribosyltranferase in complex with Inosine 5' monophosphate
Class: transferase
Keywords: inhibitor, complex, dimer, enzyme, TRANSFERASE
Deposited on 2016-06-01, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kama_
  • Chain 'C':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kamc_
  • Heterogens: IMP, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kamA (A:)
    hhhhhhmepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlk
    gsfvftadmvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvled
    ildtaltlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldy
    dqsyrevrdvvilkpsvyetwgkelerrkaageakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kamA (A:)
    tsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmvrilgdf
    gvptrveflrrgkhvlvledildtaltlrevvdslkksepasiktlvaidkpggrkipft
    aeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kamC (C:)
    hhhhhhmepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlk
    gsfvftadmvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvled
    ildtaltlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldy
    dqsyrevrdvvilkpsvyetwgkelerrkaageakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kamC (C:)
    ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
    rilgdfgvptrveflrirgkhvlvledildtaltlrevvdslkksepasiktlvaidkpg
    grkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgkel