PDB entry 5kal

View 5kal on RCSB PDB site
Description: terminal uridylyl transferase 4 from trypanosoma brucei with bound utp and upu
Deposited on 2016-06-01, released 2016-10-26
The last revision was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA uridylyltransferase 4
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: TUT4
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: RNA uridylyltransferase 4
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: TUT4
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: RNA (5'-r(*up*u)-3')
    Species: Trypanosoma brucei, synthetic [TaxId:5691]
  • Chain 'Z':
    Compound: RNA (5'-r(*up*u)-3')
    Species: Trypanosoma brucei, synthetic [TaxId:5691]
  • Heterogens: UTP, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kalA (A:)
    mgsshhhhhhssglvprgshmppspavvgrslvnsfkqfvskdlhtrhvdatyrlvldcv
    aavdplmrlytfgstvvygvhekgsdvdfvvlnktdvedgkggdaatqvakglqadilak
    larvirqkhlswnveevrrtrvpvvrvkgggavdfditayrrngvrnsallrayfeqnpp
    crwlsmsikrwskqtglnasviggsitsygfnlmvvyyllqrnhlqfvppstidvsrvep
    lpphlpleepadeglelgtqvldflhfflhefdsdkqvislnrpgittkeeldwtksaed
    farmngekvhyqwciedpyelnlnvgrnvtplkrdflrrhlekardtalltiv
    

    Sequence, based on observed residues (ATOM records):
    >5kalA (A:)
    ppspavvgrslvnsfkqfvshvdatyrlvldcvaavdplmrlytfgstvvygvhekgsdv
    dfvvlnktdvedgkggdaatqvakglqadilaklarvirqkhlswnveevrrtrvpvvrv
    kgggavdfditayrrngvrnsallrayfeqnppcrwlsmsikrwskqtglnasviggsit
    sygfnlmvvyyllqrnhlqfvppstidvsrveplpphlpleepadeglelgtqvldflhf
    flhefdsdkqvislnrpgittkeeldwtksaedfarmngekvhyqwciedpyelnlnvgr
    nvtplkrdflrrhlekardtallti
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kalB (B:)
    mgsshhhhhhssglvprgshmppspavvgrslvnsfkqfvskdlhtrhvdatyrlvldcv
    aavdplmrlytfgstvvygvhekgsdvdfvvlnktdvedgkggdaatqvakglqadilak
    larvirqkhlswnveevrrtrvpvvrvkgggavdfditayrrngvrnsallrayfeqnpp
    crwlsmsikrwskqtglnasviggsitsygfnlmvvyyllqrnhlqfvppstidvsrvep
    lpphlpleepadeglelgtqvldflhfflhefdsdkqvislnrpgittkeeldwtksaed
    farmngekvhyqwciedpyelnlnvgrnvtplkrdflrrhlekardtalltiv
    

    Sequence, based on observed residues (ATOM records):
    >5kalB (B:)
    ppspavvgrslvnsfkvdatyrlvldcvaavdplmrlytfgstvvygvhekgsdvdfvvl
    nktdvedgkggdaatqvakglqadilaklarvirqkhlswnveevrrtrvpvvrvkgdfd
    itayrrngvrnsallrayfeqnppcrwlsmsikrwskqtglnasviggsitsygfnlmvv
    yyllqrnhlqfvppstidvsrveplpphlpleepadeglelgtqvldflhfflhefdsdk
    qvislnrpgittkeeldwtksaedfarmngekvhyqwciedpyelnlnvgrnvtplkrdf
    lrrhlekardtallti
    

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.