PDB entry 5kaj

View 5kaj on RCSB PDB site
Description: crystal structure of a dioxygenase in the crotonase superfamily in p21, a319c mutant
Deposited on 2016-06-01, released 2017-06-21
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Chain 'B':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Chain 'C':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Chain 'D':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Chain 'E':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Chain 'F':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Chain 'G':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Chain 'H':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Chain 'I':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Chain 'J':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Chain 'K':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Chain 'L':
    Compound: (3,5-dihydroxyphenyl)acetyl-CoA 1,2-dioxygenase
    Species: Streptomyces toyocaensis [TaxId:55952]
    Gene: BU52_01220
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KLK7
      • engineered mutation (318)
  • Heterogens: YE2, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5kajA (A:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajA (A:)
    tdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavyd
    rltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlr
    splagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaed
    gqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdf
    lmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlas
    sdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepd
    eldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5kajB (B:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajB (B:)
    tdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavyd
    rltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlr
    splagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaed
    gqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdf
    lmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlas
    sdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepd
    eldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghdvi
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5kajC (C:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajC (C:)
    dglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavydr
    ltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlrs
    plagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaedg
    qqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdfl
    mrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlass
    dayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepde
    ldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghdvid
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5kajD (D:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajD (D:)
    tdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavyd
    rltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlr
    splagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaed
    gqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdf
    lmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlas
    sdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepd
    eldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghdvi
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >5kajE (E:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajE (E:)
    tdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavyd
    rltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlr
    splagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaed
    gqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdf
    lmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlas
    sdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepd
    eldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghdvid
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5kajF (F:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajF (F:)
    dglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavydr
    ltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlrs
    plagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaedg
    qqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdfl
    mrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlass
    dayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepde
    ldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghdvid
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >5kajG (G:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajG (G:)
    tdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavyd
    rltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlr
    splagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaed
    gqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdf
    lmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlas
    sdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepd
    eldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghdvid
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >5kajH (H:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajH (H:)
    tdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavyd
    rltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlr
    splagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaed
    gqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdf
    lmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlas
    sdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepd
    eldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghdvid
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >5kajI (I:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajI (I:)
    dglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavydr
    ltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlrs
    plagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaedg
    qqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdfl
    mrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlass
    dayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepde
    ldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghdvi
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >5kajJ (J:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajJ (J:)
    dglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavydr
    ltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlrs
    plagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaedg
    qqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdfl
    mrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlass
    dayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepde
    ldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghdvi
    

  • Chain 'K':
    Sequence, based on SEQRES records:
    >5kajK (K:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajK (K:)
    tdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavyd
    rltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlr
    splagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaed
    gqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdf
    lmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlas
    sdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepd
    eldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghdvi
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >5kajL (L:)
    mttvlppledtdglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrf
    ldthadavydrltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheid
    qgiflravlrsplagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltm
    crddrlnaedgqqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkyl
    sqggislvdflmrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaql
    llvfdrvlassdayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepear
    llvdevvepdeldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrl
    yghdvidkvgrfggrppa
    

    Sequence, based on observed residues (ATOM records):
    >5kajL (L:)
    dglwaalteaaasvekllatlpehgarssaeraeiaaahdaaralrvrfldthadavydr
    ltdhrrvhlrlaelveaaatafpglvptqqqlaverslpqaakegheidqgiflravlrs
    plagphlldamlrptpralellpefvrtgevemeavhlerrdgvarltmcrddrlnaedg
    qqvddmetavdlalldpgvrvgllrggvmshpryrgkrvfsaginlkylsqggislvdfl
    mrrelgyihklvrgvltnddrpgwwhspriekpwvaavdgfaigggaqlllvfdrvlass
    dayfslpcakegiipgaanlrlgrfagprvsrqvilegrriwakepearllvdevvepde
    ldaaiersltrldgdavlanrrmlnladespdgfraymaefalmqalrlyghdvid