PDB entry 5kae

View 5kae on RCSB PDB site
Description: Crystal structure of human PI3K-gamma in complex with quinoline-containing inhibitor 5g
Class: Transferase/Transferase Inhibitor
Keywords: phosphotransferase, inhibitor, inflammatory disease, Transferase-Transferase Inhibitor complex
Deposited on 2016-06-01, released 2017-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kaea1, d5kaea2, d5kaea3, d5kaea4
  • Heterogens: SO4, 6RF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kaeA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
    sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeew
    plvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvfv
    eaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapalss
    kasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadklt
    satnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatdp
    lnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsald
    vgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfllk
    rglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqviemlq
    kvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekckv
    maskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldlc
    llpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfqa
    averfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginkerv
    pfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpqlt
    skedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kaeA (A:)
    sqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtskp
    lpeylwkkianncifivihrsttsqtikvspddtpgailqsfftdfvlrvcgrdeylvge
    tpiknfqwvrhclkngeeihvvldtppdpaldevrkevslwdcdrkfrvkirgidipvld
    ltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkv
    qllyyvnlllidhrfllrrgeyvlhmwqisgsfnadkltsatnpdkensmsisilldnpi
    alpkhvraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvk
    wgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvl
    hyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavil
    eaylrgcgtamlhdftqqvqviemlqkvtldikslsavssqvisqlkqklenlqnsqlpe
    sfrvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqd
    mlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntga
    fkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlf
    hidfghikervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfs
    mmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvl