PDB entry 5k9x

View 5k9x on RCSB PDB site
Description: Crystal structure of Tryptophan synthase alpha chain from Legionella pneumophila subsp. pneumophila
Class: lyase
Keywords: Tryptophan synthase, structural genomics, CSGID, trpA, Center for Structural Genomics of Infectious Diseases, LYASE
Deposited on 2016-06-01, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) [TaxId:272624]
    Gene: trpA, lpg1305
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZVY3 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5k9xa1, d5k9xa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k9xA (A:)
    snamnridktleklkanrkkmlspyitagdpypeltvslmhqlvksgadvlelgipfsdp
    maegpviqrameralahsihcddvlnmvrqfrktdtetpvilmgylnpieqygydlfaqq
    aveagvdgtilvdlppeeadgvsrvwqkhglysiylcspttsaermnyinqhangylyyv
    slkgvtgsdalklpelkaqylqrkaqsklplmvgfgiktpemaaqvaefadgvivgaali
    neiieayeakkdplqasgallssmrqaidnigsmv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k9xA (A:)
    amnridktleklkanrkkmlspyitagdpypeltvslmhqlvksgadvlelgipfsdegp
    viqrameralahsihcddvlnmvrqfrktdtetpvilmgylnpieqygydlfaqqaveag
    vdgtilvdlppeeadgvsrvwqkhglysiylcspttsaermnyinqhangylyyvslalk
    lpelkaqylqrkaqsklplmvgfgiktpemaaqvaefadgvivgaalineiieayeakkd
    plqasgallssmrqaidnigsm