PDB entry 5k9r

View 5k9r on RCSB PDB site
Description: PDE10a with imidazopyrazine inhibitor
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2016-06-01, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (0-311)
      • conflict (209)
    Domains in SCOPe 2.07: d5k9ra_
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y233 (0-311)
      • conflict (209)
    Domains in SCOPe 2.07: d5k9rb_
  • Heterogens: ZN, MG, 6RC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k9rA (A:)
    glmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkk
    nyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqk
    fdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlal
    yfgnrkqleemyqtgslnlnnqshrdrvislmmtacdlcsvtklwpvtkltandiyaefw
    aegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrd
    nlsqwekvirge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k9rB (B:)
    glmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkk
    nyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqk
    fdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlal
    yfgnrkqleemyqtgslnlnnqshrdrvislmmtacdlcsvtklwpvtkltandiyaefw
    aegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrd
    nlsqwekvirge