PDB entry 5k9m

View 5k9m on RCSB PDB site
Description: crystal structure of prib binary complex with product diphosphate
Deposited on 2016-06-01, released 2016-06-15
The last revision was dated 2020-09-23, with a file datestamp of 2020-09-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PriB Prenyltransferase
    Species: Streptomyces sp. RM-5-8 [TaxId:1429103]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K9M
  • Heterogens: POP, TRS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k9mA (A:)
    mgsshhhhhhssglvprgshmggpmsgfhsgeallgdlatgqltrlcevaglteadtaay
    tgvlieslgtsagrplslpppsrtflsddhtpvefslaflpgraphlrvlvepgcssgdd
    laengraglravhtmadrwgfsteqldrledlffpsspegplalwcalelrsggvpgvkv
    ylnpaangadraaetvrealarlghlqafdalpradgfpflaldlgdwdaprvkiylkhl
    gmsaadagslprmspapsreqleeffrtagdlpapgdpgptedtgrlagrpaltchsfte
    tatgrpsgytlhvpvrdyvrhdgeardravavlrehdmdsaaldralaavsprplsdgvg
    liaylalvhqrgrptrvtvyvsseayevrppretvptrdrararl
    

    Sequence, based on observed residues (ATOM records):
    >5k9mA (A:)
    allgdlatgqltrlcevaglteadtaaytgvlieslgtsagrplslpppsrtflsddhtp
    vefslaflpgraphlrvlvepgcssgddlaengraglravhtmadrwgfsteqldrledl
    ffpsspegplalwcalelrsggvpgvkvylnpaangadraaetvrealarlghlqafdal
    pradgfpflaldlgdwdaprvkiylkhlgmsaadagslprmspapsreqleeffrtagdl
    pgrlagrpaltchsftetatgrpsgytlhvpvrdyvrhdgeardravavlrehdmdsaal
    dralaavsprplsdgvgliaylalvhqrgrptrvtvyvsseayevrppretvp