PDB entry 5k9g

View 5k9g on RCSB PDB site
Description: crystal structure of gtp cyclohydrolase-ib with tris
Deposited on 2016-05-31, released 2016-09-07
The last revision was dated 2019-07-10, with a file datestamp of 2019-07-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP cyclohydrolase FolE2
    Species: Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) [TaxId:242231]
    Gene: folE2, NGO0387
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: GTP cyclohydrolase FolE2
    Species: Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) [TaxId:242231]
    Gene: folE2, NGO0387
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, EDO, TRS, FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k9gA (A:)
    mnaiadvqssrdlrnlpinqvgikdlrfpitlktaegtqstvarltmtvylpaeqkgthm
    srfvalmeqhtevldfaqlhrltaemvalldsragkisvsfpffrkktapvsgirslldy
    dvsltgemkdgayghsmkvmipvtslcpcskeisqygahnqrshvtvsltsdaevgieev
    idyvetqascqlygllkrpdekyvtekayenpkfvedmvrdvatsliadkriksfvvese
    nfesihnhsayayiayp
    

    Sequence, based on observed residues (ATOM records):
    >5k9gA (A:)
    lrnlpinqvgikdlrfpitlktaegtqstvarltmtvylpaeqkgthmsrfvalmeqhte
    vldfaqlhrltaemvalldsragkisvsfpffrkktapvsgirslldydvsltgemkdga
    yghsmkvmipvtslcpcskeisqygahnqrshvtvsltsdaevgieevidyvetqascql
    ygllkrpdekyvtekayenpkfvedmvrdvatsliadkriksfvvesenfesihnhsaya
    yiayp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k9gB (B:)
    mnaiadvqssrdlrnlpinqvgikdlrfpitlktaegtqstvarltmtvylpaeqkgthm
    srfvalmeqhtevldfaqlhrltaemvalldsragkisvsfpffrkktapvsgirslldy
    dvsltgemkdgayghsmkvmipvtslcpcskeisqygahnqrshvtvsltsdaevgieev
    idyvetqascqlygllkrpdekyvtekayenpkfvedmvrdvatsliadkriksfvvese
    nfesihnhsayayiayp
    

    Sequence, based on observed residues (ATOM records):
    >5k9gB (B:)
    nlpinqvgikdlrfpitlktaegtqstvarltmtvylpaeqkgthmsrfvalmeqhtevl
    dfaqlhrltaemvalldsragkisvsfpffrkktapvsgirslldydvsltgemkdgayg
    hsmkvmipvtslcpcskeisqygahnqrshvtvsltsdaevgieevidyvetqascqlyg
    llkrpdekyvtekayenpkfvedmvrdvatsliadkriksfvvesenfesihnhsayayi
    ayp