PDB entry 5k9c

View 5k9c on RCSB PDB site
Description: Crystal structure of human dihydroorotate dehydrogenase with ML390
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: Oxidoreductase, alpha/beta barrel, inhibitor, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2016-05-31, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-04, with a file datestamp of 2016-12-30.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dihydroorotate dehydrogenase (quinone), mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: DHODH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k9ca_
  • Heterogens: FNR, ORO, MLJ, SO4, ACT, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k9cA (A:)
    smatgderfyaehlmptlqglldpesahrlavrftslgllprarfqdsdmlevrvlghkf
    rnpvgiaagfdkhgeavdglykmgfgfveigsvtpkpqegnprprvfrlpedqavinryg
    fnshglsvvehrlrarqqkqakltedglplgvnlgknktsvdaaedyaegvrvlgplady
    lvvnvsspntaglrslqgkaelrrlltkvlqerdglrrvhrpavlvkiapdltsqdkedi
    asvvkelgidglivtnttvsrpaglqgalrsetgglsgkplrdlstqtiremyaltqgrv
    piigvggvssgqdalekiragaslvqlytaltfwgppvvgkvkreleallkeqgfggvtd
    aigadhrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k9cA (A:)
    erfyaehlmptlqglldpesahrlavrftslgllprarfqdsdmlevrvlghkfrnpvgi
    aagfdkhgeavdglykmgfgfveigsvtpkpqegnprprvfrlpedqavinrygfnshgl
    svvehrlrarqqkqakltedglplgvnlgknktsvdaaedyaegvrvlgpladylvvnvs
    spntgkaelrrlltkvlqerdglrrvhrpavlvkiapdltsqdkediasvvkelgidgli
    vtnttvsrpaglqgalrsetgglsgkplrdlstqtiremyaltqgrvpiigvggvssgqd
    alekiragaslvqlytaltfwgppvvgkvkreleallkeqgfggvtdaigadhrr