PDB entry 5k8z

View 5k8z on RCSB PDB site
Description: crystal structure of dimeric chlorite dismutase from cyanothece sp. pcc7425 (ph 8.5)
Deposited on 2016-05-31, released 2017-06-21
The last revision was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chlorite dismutase
    Species: Cyanothece sp. (strain PCC 7425 / ATCC 29141) [TaxId:395961]
    Gene: Cyan7425_1434
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: chlorite dismutase
    Species: Cyanothece sp. (strain PCC 7425 / ATCC 29141) [TaxId:395961]
    Gene: Cyan7425_1434
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: chlorite dismutase
    Species: Cyanothece sp. (strain PCC 7425 / ATCC 29141) [TaxId:395961]
    Gene: Cyan7425_1434
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: chlorite dismutase
    Species: Cyanothece sp. (strain PCC 7425 / ATCC 29141) [TaxId:395961]
    Gene: Cyan7425_1434
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MRD, HEM, OH, MPD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k8zA (A:)
    gpgyqdpnnrysfiggrtgqwqvvkirnvlgpglqlvekvnilngavaeipldsawrlqg
    fasniryairtelealqavqpmlnraeailavlipikksaqwwemaqderrdifereshh
    tavgleylpgvarrllhcrdlgeefdfltwfefapehssafnelllrmraskeweyvere
    vevwlkrl
    

    Sequence, based on observed residues (ATOM records):
    >5k8zA (A:)
    nnrysfiggrtgqwqvvkirnvlgpglqlvekvnilngavaeipldsawrlqgfasniry
    airtelealqavqpmlnraeailavlipikksaqwwemaqderrdifereshhtavgley
    lpgvarrllhcrdlgeefdfltwfefapehssafnelllrmraskeweyverevevwlkr
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k8zB (B:)
    gpgyqdpnnrysfiggrtgqwqvvkirnvlgpglqlvekvnilngavaeipldsawrlqg
    fasniryairtelealqavqpmlnraeailavlipikksaqwwemaqderrdifereshh
    tavgleylpgvarrllhcrdlgeefdfltwfefapehssafnelllrmraskeweyvere
    vevwlkrl
    

    Sequence, based on observed residues (ATOM records):
    >5k8zB (B:)
    nnrysfiggrtgqwqvvkirnvlgpglqlvekvnilngavaeipldsawrlqgfasniry
    airtelealqavqpmlnraeailavlipikksaqwwemaqderrdifereshhtavgley
    lpgvarrllhcrdlgeefdfltwfefapehssafnelllrmraskeweyverevevwlkr
    l
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5k8zC (C:)
    gpgyqdpnnrysfiggrtgqwqvvkirnvlgpglqlvekvnilngavaeipldsawrlqg
    fasniryairtelealqavqpmlnraeailavlipikksaqwwemaqderrdifereshh
    tavgleylpgvarrllhcrdlgeefdfltwfefapehssafnelllrmraskeweyvere
    vevwlkrl
    

    Sequence, based on observed residues (ATOM records):
    >5k8zC (C:)
    nnrysfiggrtgqwqvvkirnvlgpglqlvekvnilngavaeipldsawrlqgfasniry
    airtelealqavqpmlnraeailavlipikksaqwwemaqderrdifereshhtavgley
    lpgvarrllhcrdlgeefdfltwfefapehssafnelllrmraskeweyverevevwlkr
    l
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5k8zD (D:)
    gpgyqdpnnrysfiggrtgqwqvvkirnvlgpglqlvekvnilngavaeipldsawrlqg
    fasniryairtelealqavqpmlnraeailavlipikksaqwwemaqderrdifereshh
    tavgleylpgvarrllhcrdlgeefdfltwfefapehssafnelllrmraskeweyvere
    vevwlkrl
    

    Sequence, based on observed residues (ATOM records):
    >5k8zD (D:)
    nnrysfiggrtgqwqvvkirnvlgpglqlvekvnilngavaeipldsawrlqgfasniry
    airtelealqavqpmlnraeailavlipikksaqwwemaqderrdifereshhtavgley
    lpgvarrllhcrdlgeefdfltwfefapehssafnelllrmraskeweyverevevwlkr
    l