PDB entry 5k8y

View 5k8y on RCSB PDB site
Description: Structure of the Mus musclus Langerin carbohydrate recognition domain
Class: immune system
Keywords: C-TYPE LECTIN, GLYCOPROTEIN, CARBOHYDRATE BINDING PROTEIN, CALCIUM BINDING, CRD Domain, LECTIN, IMMUNE SYSTEM
Deposited on 2016-05-31, released 2016-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member K
    Species: Mus musculus [TaxId:10090]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VBX4 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.08: d5k8ya1, d5k8ya2
  • Chain 'B':
    Compound: C-type lectin domain family 4 member K
    Species: Mus musculus [TaxId:10090]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VBX4 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.08: d5k8yb1, d5k8yb2
  • Heterogens: CA, P6G, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k8yA (A:)
    magilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaad
    giphwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkcwn
    dgpcdntflfickrpyvqttegtwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k8yA (A:)
    agilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaadg
    iphwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkcwnd
    gpcdntflfickrpyv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k8yB (B:)
    magilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaad
    giphwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkcwn
    dgpcdntflfickrpyvqttegtwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k8yB (B:)
    agilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaadg
    iphwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkcwnd
    gpcdntflfickrpyv