PDB entry 5k8w

View 5k8w on RCSB PDB site
Description: crystal structure of mouse carm1 in complex with inhibitor u2
Deposited on 2016-05-31, released 2017-06-21
The last revision was dated 2017-06-21, with a file datestamp of 2017-06-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: histone-arginine methyltransferase carm1
    Species: Mus musculus [TaxId:10090]
    Gene: Carm1, Prmt4
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GJV, DXE, EDO, PG4, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k8wA (A:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5k8wA (A:)
    rsvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgc
    gsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdi
    iisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfw
    yqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieip
    fkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdt
    lsgtclliankrqsydisivaqvdqtgskssnlldlknpffryt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k8wB (B:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5k8wB (B:)
    rsvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgc
    gsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdi
    iisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfw
    yqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieip
    fkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdt
    lsgtclliankrqsydisivaqvdqtgskssnlldlknpffryt
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5k8wC (C:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5k8wC (C:)
    svfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcg
    sgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdii
    isepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwy
    qpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipf
    kfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtl
    sgtclliankrqsydisivaqvdqtgskssnlldlknpffryt
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5k8wD (D:)
    ghmghtlersvfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkd
    kivldvgcgsgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveev
    slpeqvdiiisepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlyme
    qftkanfwyqpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakeg
    dlhrieipfkfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsp
    lfakagdtlsgtclliankrqsydisivaqvdqtgskssnlldlknpffrytgttpsppp
    g
    

    Sequence, based on observed residues (ATOM records):
    >5k8wD (D:)
    svfserteessavqyfqfygylsqqqnmmqdyvrtgtyqrailqnhtdfkdkivldvgcg
    sgilsffaaqagarkiyaveastmaqhaevlvksnnltdrivvipgkveevslpeqvdii
    isepmgymlfnermlesylhakkylkpsgnmfptigdvhlapftdeqlymeqftkanfwy
    qpsfhgvdlsalrgaavdeyfrqpvvdtfdirilmaksvkytvnfleakegdlhrieipf
    kfhmlhsglvhglafwfdvafigsimtvwlstapteplthwyqvrclfqsplfakagdtl
    sgtclliankrqsydisivaqvdqtgskssnlldlknpffry