PDB entry 5k8t

View 5k8t on RCSB PDB site
Description: Crystal structure of ZIKV NS3 helicase in complex with GTP-gammar S and an magnesium ion
Class: hydrolase
Keywords: NTPase, helicase, HYDROLASE
Deposited on 2016-05-31, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ZIKV NS3 helicase
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K8T
    Domains in SCOPe 2.07: d5k8ta1, d5k8ta2
  • Heterogens: GSP, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k8tA (A:)
    gsvdgrreeetpvecfepsmlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvila
    ptrvvaaemeealrglpvrymttavnvthsgteivdlmchatftsrllqpirvpnynlyi
    mdeahftdpssiaargyistrvemgeaaaifmtatppgtrdafpdsnspimdtevevper
    awssgfdwvtdhsgktvwfvpsvrngneiaacltkagkrviqlsrktfetefqktkhqew
    dfvvttdisemganfkadrvidsrrclkpvildgervilagpmpvthasaaqrrgrigrn
    pnkpgdeylygggcaetdedhahwlearmlldniylqdgliaslyrpeadkvaaiegefk
    lrteqrktfvelmkrgdlpvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtr
    hgekrvlkprwmdarvcsdhaalksfkefaagkraaas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k8tA (A:)
    etpvecfepsmlkkkqltvldlhpgagktrrvlpeivreaiktrlrtvilaptrvvaaem
    eealrglpvrymivdlmchatftsrllqpirvpnynlyimdeahftdpssiaargyistr
    vemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgktvwfvp
    svrngneiaacltkagkrviqlsrktfetefqktkhqewdfvvttdisemganfkadrvi
    dsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeylygggcaetdedh
    ahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdlpvw
    layqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarvcsdha
    alksfkefaagkraaa