PDB entry 5k8s

View 5k8s on RCSB PDB site
Description: cAMP bound PfPKA-R (297-441)
Class: transferase
Keywords: Plasmodium falciparum, PKA, protein kinase A, cAMP, CBD, cyclic nucleotide binding, CNB, regulatory domain, R, TRANSFERASE
Deposited on 2016-05-31, released 2016-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase regulatory subunit
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PKAr, PFL1110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KQK0 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5k8sa1, d5k8sa2
  • Chain 'B':
    Compound: cAMP-dependent protein kinase regulatory subunit
    Species: Plasmodium falciparum (isolate 3D7) [TaxId:36329]
    Gene: PKAr, PFL1110c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7KQK0 (3-147)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5k8sb1, d5k8sb2
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k8sA (A:)
    gpgakkrkmyedilshvnilkdmdpyerckvadclksksyndgeiiikegeegdtffili
    dgnavaskdnkviktytkgdyfgelallknkpraatikaqnfcqvvyldrksfkrllgpi
    edilhrnvenykkvlnelgldttciden
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k8sA (A:)
    gpgakkrkmyedilshvnilkdmdpyerckvadclksksyndgeiiikegeegdtffili
    dgnavaskdnkviktytkgdyfgelallknkpraatikaqnfcqvvyldrksfkrllgpi
    edilhrnvenykkvlnelgldttcid
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k8sB (B:)
    gpgakkrkmyedilshvnilkdmdpyerckvadclksksyndgeiiikegeegdtffili
    dgnavaskdnkviktytkgdyfgelallknkpraatikaqnfcqvvyldrksfkrllgpi
    edilhrnvenykkvlnelgldttciden