PDB entry 5k8m

View 5k8m on RCSB PDB site
Description: apo 5-nitroanthranilate aminohydrolase
Deposited on 2016-05-30, released 2016-10-05
The last revision was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-nitroanthranilic acid aminohydrolase
    Species: Bradyrhizobium sp. [TaxId:376]
    Gene: naaA
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 5-nitroanthranilic acid aminohydrolase
    Species: Bradyrhizobium sp. [TaxId:376]
    Gene: naaA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 5-nitroanthranilic acid aminohydrolase
    Species: Bradyrhizobium sp. [TaxId:376]
    Gene: naaA
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 5-nitroanthranilic acid aminohydrolase
    Species: Bradyrhizobium sp. [TaxId:376]
    Gene: naaA
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k8mA (A:)
    magsndvakvmktldgmregliqtavelgsieaptgregaagdyvyewmarngfgpervg
    vfddrfnvvgrlrgtgggaslsfnshldtimaredtarfadandriyheawheegriygy
    svvnckgpmacwliaakalkeagaalkgdvvltavcgeidcepvdefqghdylaedigar
    yaishgaisdyalvaeatnfkpawveagkvflkvtvfagpsrytpyvprpvaaldspnai
    vrmaklvealeewadnyekrytreygggtvvpkvaigairggvpykiyrfpelcsiymdi
    rlnpdtnplvvqreveavvsklglkaevkpflfrrgyeaqgieplqnalevahrevvgrp
    terpgspecsmwrdtnpynelgipsltygcgggagggntyflvddmlkaakvyamtamdl
    cnrtp
    

    Sequence, based on observed residues (ATOM records):
    >5k8mA (A:)
    dvakvmktldgmregliqtavelgsieaptgregaagdyvyewmarngfgpervgvfddr
    fnvvgrlrgtgggaslsfnshldtieawheegriygysvvnckgpmacwliaakalkeag
    aalkgdvvltavcgeidcepvdefqghdylaedigaryaishgaisdyalvaeatnfkpa
    wveagkvflkvtvfagpsrytpyvprpvaaldspnaivrmaklvealeewadnyekrytr
    eygggtvvpkvaigairggvpykiyrfpelcsiymdirlnpdtnplvvqreveavvsklg
    lkaevkpflfrrgyeaqgieplqnalevahrevvgrpterpgspecsmwrdtnpynelgi
    psltygcggntyflvddmlkaakvyamtamdlcnrtp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k8mB (B:)
    magsndvakvmktldgmregliqtavelgsieaptgregaagdyvyewmarngfgpervg
    vfddrfnvvgrlrgtgggaslsfnshldtimaredtarfadandriyheawheegriygy
    svvnckgpmacwliaakalkeagaalkgdvvltavcgeidcepvdefqghdylaedigar
    yaishgaisdyalvaeatnfkpawveagkvflkvtvfagpsrytpyvprpvaaldspnai
    vrmaklvealeewadnyekrytreygggtvvpkvaigairggvpykiyrfpelcsiymdi
    rlnpdtnplvvqreveavvsklglkaevkpflfrrgyeaqgieplqnalevahrevvgrp
    terpgspecsmwrdtnpynelgipsltygcgggagggntyflvddmlkaakvyamtamdl
    cnrtp
    

    Sequence, based on observed residues (ATOM records):
    >5k8mB (B:)
    ndvakvmktldgmregliqtavelgsieaptgregaagdyvyewmarngfgpervgvfdd
    rfnvvgrlrgtgggaslsfnshldtimheawheegriygysvvnckgpmacwliaakalk
    eagaalkgdvvltavcgeidcepvdefqghdylaedigaryaishgaisdyalvaeatnf
    kpawveagkvflkvtvfagpsrytpyvprpvaaldspnaivrmaklvealeewadnyekr
    ytreygggtvvpkvaigairggvpykiyrfpelcsiymdirlnpdtnplvvqreveavvs
    klglkaevkpflfrrgyeaqgieplqnalevahrevvgrpterpgspecsmwrdtnpyne
    lgipsltygcggntyflvddmlkaakvyamtamdlcnrtp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5k8mC (C:)
    magsndvakvmktldgmregliqtavelgsieaptgregaagdyvyewmarngfgpervg
    vfddrfnvvgrlrgtgggaslsfnshldtimaredtarfadandriyheawheegriygy
    svvnckgpmacwliaakalkeagaalkgdvvltavcgeidcepvdefqghdylaedigar
    yaishgaisdyalvaeatnfkpawveagkvflkvtvfagpsrytpyvprpvaaldspnai
    vrmaklvealeewadnyekrytreygggtvvpkvaigairggvpykiyrfpelcsiymdi
    rlnpdtnplvvqreveavvsklglkaevkpflfrrgyeaqgieplqnalevahrevvgrp
    terpgspecsmwrdtnpynelgipsltygcgggagggntyflvddmlkaakvyamtamdl
    cnrtp
    

    Sequence, based on observed residues (ATOM records):
    >5k8mC (C:)
    dvakvmktldgmregliqtavelgsieaptgregaagdyvyewmarngfgpervgvfddr
    fnvvgrlrgtgggaslsfnshldtimheawheegriygysvvnckgpmacwliaakalke
    agaalkgdvvltavcgeidcepvdefqghdylaedigaryaishgaisdyalvaeatnfk
    pawveagkvflkvtvfagpsrytpyvprpvaaldspnaivrmaklvealeewadnyekry
    treygggtvvpkvaigairggvpykiyrfpelcsiymdirlnpdtnplvvqreveavvsk
    lglkaevkpflfrrgyeaqgieplqnalevahrevvgrpterpgspecsmwrdtnpynel
    gipsltygcggntyflvddmlkaakvyamtamdlcnrtp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5k8mD (D:)
    magsndvakvmktldgmregliqtavelgsieaptgregaagdyvyewmarngfgpervg
    vfddrfnvvgrlrgtgggaslsfnshldtimaredtarfadandriyheawheegriygy
    svvnckgpmacwliaakalkeagaalkgdvvltavcgeidcepvdefqghdylaedigar
    yaishgaisdyalvaeatnfkpawveagkvflkvtvfagpsrytpyvprpvaaldspnai
    vrmaklvealeewadnyekrytreygggtvvpkvaigairggvpykiyrfpelcsiymdi
    rlnpdtnplvvqreveavvsklglkaevkpflfrrgyeaqgieplqnalevahrevvgrp
    terpgspecsmwrdtnpynelgipsltygcgggagggntyflvddmlkaakvyamtamdl
    cnrtp
    

    Sequence, based on observed residues (ATOM records):
    >5k8mD (D:)
    vakvmktldgmregliqtavelgsieaptgregaagdyvyewmarngfgpervgvfddrf
    nvvgrlrgtgggaslsfnshldtimheawheegriygysvvnckgpmacwliaakalkea
    gaalkgdvvltavcgeidcepvdefqghdylaedigaryaishgaisdyalvaeatnfkp
    awveagkvflkvtvfagpsrytpyvprpvaaldspnaivrmaklvealeewadnyekryt
    reygggtvvpkvaigairggvpykiyrfpelcsiymdirlnpdtnplvvqreveavvskl
    glkaevkpflfrrgyeaqgieplqnalevahrevvgrpterpgspecsmwrdtnpynelg
    ipsltygcggntyflvddmlkaakvyamtamdlcnrtp