PDB entry 5k8j

View 5k8j on RCSB PDB site
Description: structure of caulobacter crescentus vapbc1 (apo form)
Deposited on 2016-05-30, released 2016-12-28
The last revision was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: VapB family protein
    Species: Caulobacter crescentus [TaxId:190650]
    Gene: CC_0032
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AC34 (7-84)
      • expression tag (5-6)
  • Chain 'B':
    Compound: Ribonuclease VapC
    Species: Caulobacter crescentus [TaxId:190650]
    Gene: vapC, CC_0031
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ribonuclease VapC
    Species: Caulobacter crescentus [TaxId:190650]
    Gene: vapC, CC_0031
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: VapB family protein
    Species: Caulobacter crescentus [TaxId:190650]
    Gene: CC_0032
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AC34 (7-End)
      • expression tag (1-6)
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k8jA (A:)
    mhhhhhharatgktfrsgnseavrlprdlafgadveltlirsgdvltiypskgsiadlva
    tlnqmprpdsveirdedlfperpgl
    

    Sequence, based on observed residues (ATOM records):
    >5k8jA (A:)
    hharatgktfrsgnseavrlprdlafgadveltlirsgdvltiypskgsiadlvatlnqm
    prpdsveirdedlfperpgl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k8jB (B:)
    mayvldtnvaihlrdgdpevttrvtalngaillsiisrveleggvyreaaqaglrrsrld
    vmlkvlpvldfdgaaadeyrrivesagysrrkvvdrmiaaqalahratfvtfnaddfrdi
    pglsllaw
    

    Sequence, based on observed residues (ATOM records):
    >5k8jB (B:)
    ayvldtnvaihlrdgdpevttrvtalngaillsiisrveleggvyreaaqaglrrsrldv
    mlkvlpvldfdgaaadeyrrivesagysrrkvvdrmiaaqalahratfvtfnaddfrdip
    glsllaw
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5k8jC (C:)
    mayvldtnvaihlrdgdpevttrvtalngaillsiisrveleggvyreaaqaglrrsrld
    vmlkvlpvldfdgaaadeyrrivesagysrrkvvdrmiaaqalahratfvtfnaddfrdi
    pglsllaw
    

    Sequence, based on observed residues (ATOM records):
    >5k8jC (C:)
    ayvldtnvaihlrdgdpevttrvtalngaillsiisrveleggvyreaaqaglrrsrldv
    mlkvlpvldfdgaaadeyrrivesagysrrkvvdrmiaaqalahratfvtfnaddfrdip
    glsllaw
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >5k8jD (D:)
    mhhhhhharatgktfrsgnseavrlprdlafgadveltlirsgdvltiypskgsiadlva
    tlnqmprpdsveirdedlfperpgl
    

    Sequence, based on observed residues (ATOM records):
    >5k8jD (D:)
    hhhhhharatgktfrsgnseavrlprdlafgadveltlirsgdvltiypskgsiadlvat
    lnqmprpd