PDB entry 5k8d

View 5k8d on RCSB PDB site
Description: crystal structure of rfviiifc
Deposited on 2016-05-29, released 2017-06-14
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 4.19 Å
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factor viii
    Species: Homo sapiens [TaxId:9606]
    Gene: F8, F8C
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Coagulation factor VIII,Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, CU

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k8dA (A:)
    atrryylgavelswdymqsdlgelpvdarfpprvpksfpfntsvvykktlfveftdhlfn
    iakprppwmgllgptiqaevydtvvitlknmashpvslhavgvsywkasegaeyddqtsq
    rekeddkvfpggshtyvwqvlkengpmasdplcltysylshvdlvkdlnsgligallvcr
    egslakektqtlhkfillfavfdegkswhsetknslmqdrdaasarawpkmhtvngyvnr
    slpgligchrksvywhvigmgttpevhsifleghtflvrnhrqasleispitfltaqtll
    mdlgqfllfchisshqhdgmeayvkvdscpeepqlrmknneeaedydddltdsemdvvrf
    dddnspsfiqirsvakkhpktwvhyiaaeeedwdyaplvlapddrsyksqylnngpqrig
    rkykkvrfmaytdetfktreaiqhesgilgpllygevgdtlliifknqasrpyniyphgi
    tdvrplysrrlpkgvkhlkdfpilpgeifkykwtvtvedgptksdprcltryyssfvnme
    rdlasgligpllicykesvdqrgnqimsdkrnvilfsvfdenrswylteniqrflpnpag
    vqledpefqasnimhsingyvfdslqlsvclhevaywyilsigaqtdflsvffsgytfkh
    kmvyedtltlfpfsgetvfmsmenpglwilgchnsdfrnrgmtallkvsscdkntgdyye
    dsyedisayllsknnaiepr
    

    Sequence, based on observed residues (ATOM records):
    >5k8dA (A:)
    atrryylgavelswdymvvykktlfveftdhlfrppwmgllgptiqaevydtvvitlknm
    ashpvslhavgvsywkasegaeyddqtsqrekeddkvfpggshtyvwqvlkengpmasdp
    lcltysylshvdlvkdlnsgligallvcregslakektqtlhkfillfavfdegkswwpk
    mhtvngyvnrslpgligchrksvywhvigmgttpevhsifleghtflvrnhrqasleisp
    itfltaqtllmdlgqfllfchisshqhdgmeayvkvdscpeepqakkhpktwvhyiaaee
    edwdyaplvlapddrsyksqylnngpqrigrkykkvrfmaytdetfktreaiqhesgilg
    pllygevgdtlliifknqasrpyniyphgitdvrplysrrlpkgvkhlkdfpilpgeifk
    ykwtvtvedgptksdprcltryyssfvnmerdlasgligpllicyrnvilfsvfdenrsw
    ylteniqrflpnpagvqledpefqasnimhsingyvfdslqlsvclhevaywyilsigaq
    tdflsvffsgytfkhkmvyedtltlfpfsgetvfmsmenpglwilgchnsdfrnrgmtal
    lkvsscdkntg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k8dB (B:)
    ktrhyfiaaverlwdygmsssphvlrnraqsgsvpqfkkvvfqeftdgsftqplyrgeln
    ehlgllgpyiraevednimvtfrnqasrpysfysslisyeedqrqgaeprknfvkpnetk
    tyfwkvqhhmaptkdefdckawayfsdvdlekdvhsgligpllvchtntlnpahgrqvtv
    qefalfftifdetkswyftenmerncrapcniqmedptfkenyrfhaingyimdtlpglv
    maqdqrirwyllsmgsnenihsihfsghvftvrkkeeykmalynlypgvfetvemlpska
    giwrvecligehlhagmstlflvysnkcqtplgmasghirdfqitasgqygqwapklarl
    hysgsinawstkepfswikvdllapmiihgiktqgarqkfsslyisqfiimysldgkkwq
    tyrgnstgtlmvffgnvdssgikhnifnppiiaryirlhpthysirstlrmelmgcdlns
    csmplgmeskaisdaqitassyftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvd
    fqktmkvtgvttqgvkslltsmyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpv
    vnsldpplltrylrihpqswvhqialrmevlgceaqdlydkthtcppcpapellggpsvf
    lfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynstyr
    vvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrdeltkn
    qvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgn
    vfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records):
    >5k8dB (B:)
    ktrhyfiaaverlwdygmssvpqfkkvvfqeftdgsftqplyrgelnehlgllgpyirae
    vednimvtfrnqasrpysfysslisyeedqrqgaeprknfvkpnetktyfwkvqhhmapt
    kdefdckawayfsdvdlekdvhsgligpllvchtntlnpahgrqvtvqefalfftifdet
    kswyftenmerncmedptfkenyrfhaingyimdtlpglvmaqdqrirwyllsmgsneni
    hsihfsghvftvrkkeeykmalynlypgvfetvemlpskagiwrvecligehlhagmstl
    flvysnkcqtplgmasghirdfqitasgqygqwapklarlhysgsinawstkepfswikv
    dllapmiihgiktqgarqkfsslyisqfiimysldgkkwqtyrgnstgtlmvffgnvdss
    gikhnifnppiiaryirlhpthysirstlrmelmgcdlnscsmplgmeskaisdaqitas
    syftnmfatwspskarlhlqgrsnawrpqvnnpkewlqvdfqktmkvtgvttqgvksllt
    smyvkeflisssqdghqwtlffqngkvkvfqgnqdsftpvvnsldpplltrylrihpqsw
    vhqialrmevlgceaqdly