PDB entry 5k8c

View 5k8c on RCSB PDB site
Description: x-ray structure of kdnb, 3-deoxy-alpha-d-manno-octulosonate 8-oxidase, from shewanella oneidensis
Deposited on 2016-05-28, released 2016-06-15
The last revision was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-alpha-D-manno-octulosonate 8-oxidase
    Species: Shewanella oneidensis (strain MR-1) [TaxId:211586]
    Gene: kdnB, SO_2477
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EEB0 (2-357)
      • expression tag (0-1)
  • Heterogens: NAD, PO4, CL, EDO, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5k8cA (A:)
    ghmsfknfkvvekmifgrgsfvqlddvlaaqrkadddfvvflvddvhqgkplearipvka
    qdlliwvnvdeepstiqidalteqvqafngklpvsvvglgggstmdvakavslmltnpgg
    samyqgwdlikkpavhhigiptisgtgaeasrtavlcgpvrklglnsdytvfdqiimdse
    lidgvetdqwfytgmdcyihcveslegtflnefskayaekamdlcrqvyledhpekddkl
    mmasfmggmsiaysqvgachavsyglsyilgyhhgignciafdvleefypegvaefrlmm
    kkhnitlpknickdlpdetiakmvavtksmgplwanvygptweekvtdemltalfrri