PDB entry 5k82

View 5k82 on RCSB PDB site
Description: Crystal Structure of a Primate APOBEC3G N-Terminal Domain
Class: hydrolase
Keywords: APOBEC3G, Vif, HIV, APOBEC, HYDROLASE
Deposited on 2016-05-27, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G,Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G
    Species: Macaca mulatta [TaxId:9544]
    Gene: APOBEC3G
    Database cross-references and differences (RAF-indexed):
    • Uniprot M1GSK9 (Start-142)
      • linker (143-146)
    • Uniprot M1GSK9 (147-195)
    Domains in SCOPe 2.07: d5k82a_
  • Chain 'B':
    Compound: Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G,Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G
    Species: Macaca mulatta [TaxId:9544]
    Gene: APOBEC3G
    Database cross-references and differences (RAF-indexed):
    • Uniprot M1GSK9 (Start-142)
      • linker (143-146)
    • Uniprot M1GSK9 (147-195)
    Domains in SCOPe 2.07: d5k82b_
  • Chain 'C':
    Compound: Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G,Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G
    Species: Macaca mulatta [TaxId:9544]
    Gene: APOBEC3G
    Database cross-references and differences (RAF-indexed):
    • Uniprot M1GSK9 (Start-142)
      • linker (143-146)
    • Uniprot M1GSK9 (147-195)
    Domains in SCOPe 2.07: d5k82c_
  • Chain 'D':
    Compound: Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G,Apolipoprotein B mRNA editing enzyme, catalytic peptide-like 3G
    Species: Macaca mulatta [TaxId:9544]
    Gene: APOBEC3G
    Database cross-references and differences (RAF-indexed):
    • Uniprot M1GSK9 (5-142)
      • linker (143-146)
    • Uniprot M1GSK9 (147-195)
    Domains in SCOPe 2.07: d5k82d_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k82A (A:)
    gpagsmkpqirnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifq
    gkvypkakyhpemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvt
    ltifvarlyyfwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlp
    khytllqatlgellrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k82A (A:)
    qirnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifqgkvypkak
    yhpemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvtltifvarl
    yyfwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlpkhytllqa
    tlgellrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k82B (B:)
    gpagsmkpqirnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifq
    gkvypkakyhpemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvt
    ltifvarlyyfwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlp
    khytllqatlgellrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k82B (B:)
    qirnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifqgkvypkak
    yhpemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvtltifvarl
    yyfwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlpkhytllqa
    tlgellrh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5k82C (C:)
    gpagsmkpqirnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifq
    gkvypkakyhpemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvt
    ltifvarlyyfwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlp
    khytllqatlgellrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k82C (C:)
    qirnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifqgkvypkak
    yhpemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvtltifvarl
    yyfwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlpkhytllqa
    tlgellrh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5k82D (D:)
    gpagsmkpqirnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifq
    gkvypkakyhpemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvt
    ltifvarlyyfwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlp
    khytllqatlgellrh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k82D (D:)
    mkpqirnmvepmdprtfvsnfnnrpilsgldtvwlccevktkdpsgppldakifqgkvyp
    kakyhpemrflrwfhkwrqlhhdqeykvtwyvswspctrcansvatflakdpkvtltifv
    arlyyfwkpdyqqalrilaeagatmkimnynefqdcwnkfvdgrgkpfkpwnnlpkhytl
    lqatlgellrh