PDB entry 5k7v

View 5k7v on RCSB PDB site
Description: computational design of self-assembling cyclic protein homooligomers
Deposited on 2016-05-26, released 2017-04-12
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 3.17 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Designed protein HR00C3
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K7V
  • Chain 'B':
    Compound: Designed protein HR00C3
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K7V
  • Chain 'C':
    Compound: Designed protein HR00C3
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K7V
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k7vA (A:)
    mieevvaemidilaesskksieelaraadnkttekavaeaieeiarlataaiqliealak
    nlaseefmaraisaiaelakkaieaiyrladnhttdtfmaraiaaianlavtailaiaal
    asnhtteefmaraisaiaelakkaieaiyrladnhttdkfmaaaieaiallatlailaia
    llasnhtteefmakaisaiaelakkaieaiyrladnhtsptyiekaieaiekiarkaika
    iemlaknitteeykekaksaideirekakeaikrlednrtlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5k7vA (A:)
    ieevvaemidilaesskksieelaraadnkttekavaeaieeiarlataaiqliealakn
    laseefmaraisaiaelakkaieaiyrladnhttdtfmaraiaaianlavtailaiaala
    snhtteefmaraisaiaelakkaieaiyrladnhttdkfmaaaieaiallatlailaial
    lasnhtteefmakaisaiaelakkaieaiyrladnhtsptyiekaieaiekiarkaikai
    emlaknitteeykekaksaideirekakeaikrlednrt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k7vB (B:)
    mieevvaemidilaesskksieelaraadnkttekavaeaieeiarlataaiqliealak
    nlaseefmaraisaiaelakkaieaiyrladnhttdtfmaraiaaianlavtailaiaal
    asnhtteefmaraisaiaelakkaieaiyrladnhttdkfmaaaieaiallatlailaia
    llasnhtteefmakaisaiaelakkaieaiyrladnhtsptyiekaieaiekiarkaika
    iemlaknitteeykekaksaideirekakeaikrlednrtlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5k7vB (B:)
    ieevvaemidilaesskksieelaraadnkttekavaeaieeiarlataaiqliealakn
    laseefmaraisaiaelakkaieaiyrladnhttdtfmaraiaaianlavtailaiaala
    snhtteefmaraisaiaelakkaieaiyrladnhttdkfmaaaieaiallatlailaial
    lasnhtteefmakaisaiaelakkaieaiyrladnhtsptyiekaieaiekiarkaikai
    emlaknitteeykekaksaideirekakeaikrlednrt
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5k7vC (C:)
    mieevvaemidilaesskksieelaraadnkttekavaeaieeiarlataaiqliealak
    nlaseefmaraisaiaelakkaieaiyrladnhttdtfmaraiaaianlavtailaiaal
    asnhtteefmaraisaiaelakkaieaiyrladnhttdkfmaaaieaiallatlailaia
    llasnhtteefmakaisaiaelakkaieaiyrladnhtsptyiekaieaiekiarkaika
    iemlaknitteeykekaksaideirekakeaikrlednrtlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5k7vC (C:)
    ieevvaemidilaesskksieelaraadnkttekavaeaieeiarlataaiqliealakn
    laseefmaraisaiaelakkaieaiyrladnhttdtfmaraiaaianlavtailaiaala
    snhtteefmaraisaiaelakkaieaiyrladnhttdkfmaaaieaiallatlailaial
    lasnhtteefmakaisaiaelakkaieaiyrladnhtsptyiekaieaiekiarkaikai
    emlaknitteeykekaksaideirekakeaikrlednrt