PDB entry 5k7r

View 5k7r on RCSB PDB site
Description: MicroED structure of trypsin at 1.7 A resolution
Class: hydrolase
Keywords: Hydrolase
Deposited on 2016-05-26, released 2017-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: ELECTRONCRYSTALLOGRAPHY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5k7ra_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k7rA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn