PDB entry 5k7h

View 5k7h on RCSB PDB site
Description: crystal structure of aibr in complex with the effector molecule isovaleryl coenzyme a
Deposited on 2016-05-26, released 2016-12-21
The last revision was dated 2017-05-03, with a file datestamp of 2017-04-28.
Experiment type: XRAY
Resolution: 2.3499999999999996 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: Myxococcus xanthus DK 1622 [TaxId:246197]
    Gene: MXAN_4263
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: TRANSCRIPTIONAL REGULATOR, TetR FAMILY
    Species: Myxococcus xanthus DK 1622 [TaxId:246197]
    Gene: MXAN_4263
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NI, CL, IVC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k7hA (A:)
    gshmtntggrkpdegeryrailetaarlicdrgyegtsmqeiaaacrmtkaglyhhiqnk
    eqllfaimnygmdlfeeqvlsrvqdianpverlracmrhnillvtrgwskeviiilheha
    tltgetrafidarkkkyvdfleeafsqasqqglirpvdptvgafsflgmvlwiykwfkpd
    grltdeqiadgmvgmlfppfaaagdtagqagpsplrmvpsvsatgtdseda
    

    Sequence, based on observed residues (ATOM records):
    >5k7hA (A:)
    ryrailetaarlicdrgyegtsmqeiaaacrmtkaglyhhiqnkeqllfaimnygmdlfe
    eqvlsrvqdianpverlracmrhnillvtrgwskeviiilhehatltgetrafidarkkk
    yvdfleeafsqasqqglirpvdptvgafsflgmvlwiykwfkpdgrltdeqiadgmvgml
    fppf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k7hB (B:)
    gshmtntggrkpdegeryrailetaarlicdrgyegtsmqeiaaacrmtkaglyhhiqnk
    eqllfaimnygmdlfeeqvlsrvqdianpverlracmrhnillvtrgwskeviiilheha
    tltgetrafidarkkkyvdfleeafsqasqqglirpvdptvgafsflgmvlwiykwfkpd
    grltdeqiadgmvgmlfppfaaagdtagqagpsplrmvpsvsatgtdseda
    

    Sequence, based on observed residues (ATOM records):
    >5k7hB (B:)
    ryrailetaarlicdrgyegtsmqeiaaacrmtkaglyhhiqnkeqllfaimnygmdlfe
    eqvlsrvqdianpverlracmrhnillvtrgwskeviiilhehatltgetrafidarkkk
    yvdfleeafsqasqqglirpvdptvgafsflgmvlwiykwfkpdgrltdeqiadgmvgml
    fppf