PDB entry 5k7g

View 5k7g on RCSB PDB site
Description: IRAK4 in complex with AZ3862
Class: transferase/transferase inhibitor
Keywords: Inhibitor, Kinase, Protein tyrosine kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-05-26, released 2017-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k7ga_
  • Chain 'B':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k7gb_
  • Chain 'C':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k7gc_
  • Chain 'D':
    Compound: interleukin-1 receptor-associated kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: Irak4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k7gd_
  • Heterogens: SO4, 6R0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k7gA (A:)
    vsdtrfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamv
    ditteelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldg
    tpplswhmrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasekf
    aqtvmtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldi
    keeiedeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemta
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k7gA (A:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklalkqqfdq
    eikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtpplswhmrckia
    qgaanginflhenhhihrdiksanilldeaftakisdfglaravmtsrivgttaymapea
    lrgeitpksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedyidkkmn
    dadstsveamysvasqclhekknkrpdikkvqqllqemt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k7gB (B:)
    vsdtrfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamv
    ditteelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldg
    tpplswhmrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasekf
    aqtvmtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldi
    keeiedeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemta
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k7gB (B:)
    fhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkkladitteelk
    qqfdqeikvmakcqhenlvellgfssddlclvyvympngslldrlscldgtpplswhmrc
    kiaqgaanginflhenhhihrdiksanilldeaftakisdfglarvgttaymapealrge
    itpksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedyidkkmndads
    tsveamysvasqclhekknkrpdikkvqqllqemt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5k7gC (C:)
    vsdtrfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamv
    ditteelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldg
    tpplswhmrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasekf
    aqtvmtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldi
    keeiedeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemta
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k7gC (C:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkkladitteel
    kqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtpplswh
    mrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglaravmtsrivgtta
    ymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedy
    idkkmndadstsveamysvasqclhekknkrpdikkvqqllqemt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5k7gD (D:)
    vsdtrfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkklaamv
    ditteelkqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldg
    tpplswhmrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglarasekf
    aqtvmtsrivgttaymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldi
    keeiedeektiedyidkkmndadstsveamysvasqclhekknkrpdikkvqqllqemta
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k7gD (D:)
    rfhsfsfyelknvtnnfderpisvggnkmgeggfgvvykgyvnnttvavkkladitteel
    kqqfdqeikvmakcqhenlvellgfssdgddlclvyvympngslldrlscldgtpplswh
    mrckiaqgaanginflhenhhihrdiksanilldeaftakisdfglaravmtsrivgtta
    ymapealrgeitpksdiysfgvvlleiitglpavdehrepqllldikeeiedeektiedy
    idkkmndadstsveamysvasqclhekknkrpdikkvqqllqemt