PDB entry 5k6z

View 5k6z on RCSB PDB site
Description: sidekick chimera containing sidekick-2 immunoglobulin domains 1-2 and sidekick-1 immunoglobulin domains 3-4
Deposited on 2016-05-25, released 2016-09-28
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein sidekick-2,Protein sidekick-1 chimera
    Species: Mus musculus [TaxId:10090]
    Gene: Sdk1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Protein sidekick-2,Protein sidekick-1 chimera
    Species: Mus musculus [TaxId:10090]
    Gene: Sdk1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, MPD, CAC, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k6zA (A:)
    gpagaqddvppyfktepvrtqvhlegnrlvltcmaegswplefkwlhnnreltrfsleyr
    ymitsldrthagfyrcivrnrmgallqrqtevqvaymgsfeegekrqsvnhgeaavirap
    rissfprpqvtwfrdgrkippssriaitlentlvilstvapdagryyvqavndkngdnkt
    sqpitlavenvggtheamapiivvapgnrsvvagssettlecianarpveelsvhwkrng
    vrltsglhsygrrltitnptsadtgmyvceatlrgstfepararaflsiieppyftaepe
    srilgeveetmdipcramgvplptlqwykdavplsklqnprykvlpsgglhiqklspeds
    gifqcfasneggevqthtyldvtn
    

    Sequence, based on observed residues (ATOM records):
    >5k6zA (A:)
    ddvppyfktepvrtqvhlegnrlvltcmaegswplefkwlhnnreltrfsleyrymitsl
    drthagfyrcivrnrmgallqrqtevqvaymgsfeegekrqsvnhgeaaviraprissfp
    rpqvtwfrdgrkippssriaitlentlvilstvapdagryyvqavndkngdnktsqpitl
    aventheamapiivvapgnrsvvagssettlecianarpveelsvhwkrngvrltsglhs
    ygrrltitnptsadtgmyvceatlrgstfepararaflsiieppyftaepesrilgevee
    tmdipcramgvplptlqwykdavplsklqnprykvlpsgglhiqklspedsgifqcfasn
    eggevqthtyldvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k6zB (B:)
    gpagaqddvppyfktepvrtqvhlegnrlvltcmaegswplefkwlhnnreltrfsleyr
    ymitsldrthagfyrcivrnrmgallqrqtevqvaymgsfeegekrqsvnhgeaavirap
    rissfprpqvtwfrdgrkippssriaitlentlvilstvapdagryyvqavndkngdnkt
    sqpitlavenvggtheamapiivvapgnrsvvagssettlecianarpveelsvhwkrng
    vrltsglhsygrrltitnptsadtgmyvceatlrgstfepararaflsiieppyftaepe
    srilgeveetmdipcramgvplptlqwykdavplsklqnprykvlpsgglhiqklspeds
    gifqcfasneggevqthtyldvtn
    

    Sequence, based on observed residues (ATOM records):
    >5k6zB (B:)
    ddvppyfktepvrtqvhlegnrlvltcmaegswplefkwlhnnreltrfsleyrymitsl
    drthagfyrcivrnrmgallqrqtevqvaymgsfeegekrqsvnhgeaaviraprissfp
    rpqvtwfrdgrkippssriaitlentlvilstvapdagryyvqavndkngdnktsqpitl
    avenvggtheamapiivvapgnrsvvagssettlecianarpveelsvhwkrngvrltsg
    lhsygrrltitnptsadtgmyvceatlrgstfepararaflsiieppyftaepesrilge
    veetmdipcramgvplptlqwykdavplsklqnprykvlpsgglhiqklspedsgifqcf
    asneggevqthtyldvtn