PDB entry 5k6u

View 5k6u on RCSB PDB site
Description: sidekick-1 immunoglobulin domains 1-4, crystal form 1
Deposited on 2016-05-25, released 2016-09-28
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein sidekick-1
    Species: Mus musculus [TaxId:10090]
    Gene: Sdk1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, CS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k6uA (A:)
    gpalaqddvapyfktepglpqihlegnrlvltclaegswplefkwirndselttysseyk
    yiipslqkldagfyrcvvrnrmgallqrkseiqvaymgnfmdtdqrktvsqghaallnll
    pivscpqpqvtwfreghkiipssriaitlenqlvilattasdagayyvqavnekngenkt
    spfihlsvardtgtheamapiivvapgnrsvvagssettlecianarpveelsvhwkrng
    vrltsglhsygrrltitnptsadtgmyvceatlrgstfepararaflsiieppyftaepe
    srilgeveetmdipcramgvplptlqwykdavplsklqnprykvlpsgglhiqklspeds
    gifqcfasneggevqthtyldvtn
    

    Sequence, based on observed residues (ATOM records):
    >5k6uA (A:)
    qddvapyfktepglpqihlegnrlvltclaegswplefkwirndselttysseykyiips
    lqkldagfyrcvvrnrmgallqrkseiqvaymgnfmdtdqrktvsqghaallnllpivsc
    pqpqvtwfreghkiipssriaitlenqlvilattasdagayyvqavnekngenktspfih
    lsvardtgtheamapiivvapgnrsvvagssettlecianarpveelsvhwkrngvrlts
    glhsygrrltitnptsadtgmyvceatlrgstfepararaflsiieppyftaepesrilg
    eveetmdipcramgvplptlqwykdavplsklqnprykvlpsgglhiqklspedsgifqc
    fasneggevqthtyldvtn