PDB entry 5k6o

View 5k6o on RCSB PDB site
Description: structure of a gh3 b-glucosidase from cow rumen metagenome in complex with galactose
Deposited on 2016-05-25, released 2016-10-05
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: b-glucosidase
    Species: metagenome [TaxId:256318]
    Gene: glyA1
    Database cross-references and differences (RAF-indexed):
    • PDB 5K6O
  • Heterogens: GAL, SO4, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k6oA (A:)
    mniekvildwneyieaarsvvsegcvllenngtlplekgavvsifgriqthyyksgtgsg
    gmvnvthvvgvpeglklsehvtvneeleniykeweeenpfdeglgwgtepwsqpemeltd
    eivsnasaksdvaiviigrtagedkdfsdvagayklseteedmlrrvrkhfdkmvvllnv
    gslmdlnviseinpdalmviwqggmigglgtadvltgkvnpsgkltdtiayeindypste
    nfgdpvrdyyaediyvgyryfetfekskvrypfgygisytefehtvgeftadinsrtfta
    sctvkntgsvagkdvaqfyvsapqgklgkpekvlvafkktgilnpgkeekitvtvpfdrf
    asfddtgvtgaescfvleageytvyegknvresykegsftleenivteklskalapmesf
    krmkasensdgtlsvkyedvpvsdvdekkrrldnmpveipqdftaryslkdvlsgsvdme
    kfiarlsdddlacivrgegmgsslvtagtaaafggvseylrkmdipavccddgpsgmrld
    sgatafsmpngtmlastfnpdviermygftslemiynkvecllgpgmnihrnplngrnfe
    yfsedpylngtiasamlkglhkygsdgvakhfccnnqelgrqacdsvvsqralreiylkg
    feiavkeggckafmttyaqvngmwtagnydlntrilrdewgfkgivmtdwwaqvndrgge
    ptknntaamvraqndlymvtanaamnsandntlsqlsegklnraelqrcamniceyamnt
    mamkrlcrndikveiagrvieedafdienaeylvlkgnitvslknkeskagtnyyipldi
    qdlgmydisvtassmlgevaqlpctlyytgvpfltytfngsggkdvtitksmdfhnrmav
    irlnvaknglnldriefkkqq
    

    Sequence, based on observed residues (ATOM records):
    >5k6oA (A:)
    ekvildwneyieaarsvvsegcvllenngtlplekgavvsifgriqthyyksgtgsggmv
    nvthvvgvpeglklsehvtvneeleniykeweeenpfdeglgwgtepwsqpemeltdeiv
    snasaksdvaiviigrtagedkdfsdvagayklseteedmlrrvrkhfdkmvvllnvgsl
    mdlnviseinpdalmviwqggmigglgtadvltgkvnpsgkltdtiayeindypstenfg
    dpvrdyyaediyvgyryfetfekskvrypfgygisytefehtvgeftadinsrtftasct
    vkntgsvagkdvaqfyvsapqgklgkpekvlvafkktgilnpgkeekitvtvpfdrfasf
    ddtgvtgaescfvleageytvyegknvresykegsftleenivteklskalapmesfkrm
    kasensdgtlsvkyedvpvsdvdekkrrldnmpveipqdftaryslkdvlsgsvdmekfi
    arlsdddlacivrgegmgsslvtagtaaafggvseylrkmdipavccddgpsgmrldsga
    tafsmpngtmlastfnpdviermygftslemiynkvecllgpgmnihrnplngrnfeyfs
    edpylngtiasamlkglhkygsdgvakhfccnnqelgrqacdsvvsqralreiylkgfei
    avkeggckafmttyaqvngmwtagnydlntrilrdewgfkgivmtdwwaqvndrggeptk
    nntaamvraqndlymvtanaamnsandntlsqlsegklnraelqrcamniceyamntmam
    krlcrndikveiagr