PDB entry 5k6i

View 5k6i on RCSB PDB site
Description: crystal structure of prefusion-stabilized rsv f single-chain 9-10 ds- cav1 a149c-y458c, s46g-e92d-s215p-k465q variant.
Deposited on 2016-05-24, released 2016-08-17
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Fusion glycoprotein F0
    Species: Human respiratory syncytial virus A (strain A2) [TaxId:11259]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03420 (0-77)
      • engineered mutation (20)
      • engineered mutation (66)
      • engineered mutation (76)
      • linker (78-79)
    • Uniprot P03420 (80-444)
      • engineered mutation (84)
      • engineered mutation (90)
      • engineered mutation (125)
      • engineered mutation (142)
      • engineered mutation (150)
      • engineered mutation (225)
      • engineered mutation (308)
      • engineered mutation (314)
      • engineered mutation (382)
      • engineered mutation (393)
      • engineered mutation (400)
  • Heterogens: ZN, EDO, PO4, NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >5k6iF (F:)
    qniteefyqstcsavskgylgalrtgwytsvitielsnikenkcngtdakvklikqeldk
    yknavtdlqllmqstpatgsgsaicsgvavckvlhlegevnkiksallstnkavvslsng
    vsvltfkvldlknyidkqllpilnkqscsipnietviefqqknnrlleitrefsvnagvt
    tpvstymltnsellslindmpitndqkklmsnnvqivrqqsysimciikeevlayvvqlp
    lygvidtpcwklhtsplcttntkegsnicltrtdrgwycdnagsvsffpqaetckvqsnr
    vfcdtmnsrtlpsevnlcnvdifnpkydckimtsktdvsssvitslgaivscygktkcta
    snknrgiiktfsngcdyvsnkgvdtvsvgntlycvnkqegqslyvkgepiinfydplvfp
    sdefdasisqvnekinqslafirks