PDB entry 5k6h

View 5k6h on RCSB PDB site
Description: crystal structure of prefusion-stabilized rsv f single-chain 9-10 ds- cav1 a149c-y458c variant.
Deposited on 2016-05-24, released 2016-09-21
The last revision was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Fusion glycoprotein F0
    Species: Human respiratory syncytial virus A (strain A2) [TaxId:11259]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03420 (0-77)
      • engineered mutation (76)
      • linker (78-79)
    • Uniprot P03420 (80-444)
      • engineered mutation (84)
      • engineered mutation (90)
      • engineered mutation (125)
      • engineered mutation (142)
      • engineered mutation (225)
      • engineered mutation (308)
      • engineered mutation (314)
      • engineered mutation (382)
      • engineered mutation (393)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >5k6hF (F:)
    qniteefyqstcsavskgylsalrtgwytsvitielsnikenkcngtdakvklikqeldk
    yknavtelqllmqstpatgsgsaicsgvavckvlhlegevnkiksallstnkavvslsng
    vsvltfkvldlknyidkqllpilnkqscsisnietviefqqknnrlleitrefsvnagvt
    tpvstymltnsellslindmpitndqkklmsnnvqivrqqsysimciikeevlayvvqlp
    lygvidtpcwklhtsplcttntkegsnicltrtdrgwycdnagsvsffpqaetckvqsnr
    vfcdtmnsrtlpsevnlcnvdifnpkydckimtsktdvsssvitslgaivscygktkcta
    snknrgiiktfsngcdyvsnkgvdtvsvgntlycvnkqegkslyvkgepiinfydplvfp
    sdefdasisqvnekinqslafirks