PDB entry 5k6b

View 5k6b on RCSB PDB site
Description: crystal structure of prefusion-stabilized rsv f single-chain 9 ds-cav1 variant.
Deposited on 2016-05-24, released 2016-08-31
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.98 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: Fusion glycoprotein F0
    Species: Human respiratory syncytial virus A [TaxId:11259]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03420 (0-79)
      • engineered mutation (76)
      • linker (80-81)
    • Uniprot P03420 (82-End)
      • engineered mutation (92)
      • engineered mutation (127)
      • engineered mutation (144)
      • engineered mutation (227)
      • engineered mutation (310)
      • engineered mutation (316)
      • engineered mutation (384)
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5k6bF (F:)
    qniteefyqstcsavskgylsalrtgwytsvitielsnikenkcngtdakvklikqeldk
    yknavtelqllmqstpatnngsgsaiasgvavckvlhlegevnkiksallstnkavvsls
    ngvsvltfkvldlknyidkqllpilnkqscsisnietviefqqknnrlleitrefsvnag
    vttpvstymltnsellslindmpitndqkklmsnnvqivrqqsysimciikeevlayvvq
    lplygvidtpcwklhtsplcttntkegsnicltrtdrgwycdnagsvsffpqaetckvqs
    nrvfcdtmnsrtlpsevnlcnvdifnpkydckimtsktdvsssvitslgaivscygktkc
    tasnknrgiiktfsngcdyvsnkgvdtvsvgntlyyvnkqegkslyvkgepiinfydplv
    fpsdefdasisqvnekinqslafirks
    

    Sequence, based on observed residues (ATOM records):
    >5k6bF (F:)
    qniteefyqstcsavskgylsalrtgwytsvitielsnikenkcngtdakvklikqeldk
    yknavtelqllmqstpatnngsgsaiasgvavckvlhlegevnkiksallstnkavvsls
    ngvsvltfkvldlknyidkqllpilnkqscsisnietviefqqknnrlleitrefsvnag
    vttpvstymltnsellslindmpitndqkklmsnnvqivrqqsysimciikeevlayvvq
    lplygvidtpcwklhtsplcttntkegsnicltrtdrgwycdnagsvsffpqaetckvqs
    nrvfcdtmnsrtlpsevnlcnvdifnpkydckimtsktdvsssvitslgaivscygktkc
    tasnknrgiiktfsngcdyvsnkgvdtvsvgntlyyvnkqegkslyvkgepiinfydplv
    fpsdefdasisqvnekinqsla