PDB entry 5k66

View 5k66 on RCSB PDB site
Description: crystal structure of n-terminal amidase with asn-glu peptide
Deposited on 2016-05-24, released 2017-01-11
The last revision was dated 2017-01-11, with a file datestamp of 2017-01-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nta1p
    Species: Saccharomyces cerevisiae (strain CEN.PK113-7D) [TaxId:889517]
    Gene: CENPK1137D_1355
    Database cross-references and differences (RAF-indexed):
    • Uniprot N1P8Q8 (Start-458)
      • engineered mutation (188)
  • Heterogens: ASN, GLU, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k66A (A:)
    gsmlidaihgakmstkllvslkvlviqlnpqigqvdqtikrtwsildkvtksatyvkpdi
    ilfpefaltgysfharkdilpyvtkkdegpsfelaksisekfqcytiigypeeddeqkly
    nsalvvnpqggqifnyrktflydtemnwdceenpegfqtfpmdfskcaklsnedsynrdv
    tlkasigismdlspykfmapfnhfefssfcvdnnvelilcpmawlnstsitdkqtlhnns
    lleaaknkiafalkeqglplagsqgiyqlkigdsqrtprvpsddstseykdmdepdmsnv
    nywilrffpflyfklrinwfknssliesilgktrmpldheyykdgkhkedtidlldseev
    ikdtvlektflgtslgqpwkfqgknailvlanrcgtedgttifagssgiykfngkkpkgs
    qdddessldslnesvellgnlgkglegailrevqfevfr
    

    Sequence, based on observed residues (ATOM records):
    >5k66A (A:)
    tkllvslkvlviqlnpqigqvdqtikrtwsildkvtksatyvkpdiilfpefaltgysfh
    arkdilpyvtkkdegpsfelaksisekfqcytiigypeeddeqklynsalvvnpqggqif
    nyrktflydtemnwdceenpegfqtfpmdfskcaklsnedsynrdvtlkasigismdlsp
    ykfmapfnhfefssfcvdnnvelilcpmawlnstsitdkqtlhnnslleaaknkiafalk
    eqglplagsqgiyqlkigdsqrtprvpsddstseykdmdepdmsnvnywilrffpflyfk
    lrinwfknssliesilgktrmpldheyykkhkdlldseevikdtvlektflgtslgqpwk
    fqgknailvlanrcgtedgttifagssgiykfngkkssldslnesvellgnlgkglegai
    lrevqfevfr