PDB entry 5k64

View 5k64 on RCSB PDB site
Description: Crystal structure of VEGF binding IgG1-Fc (Fcab 448)
Class: immune system
Keywords: Immune system, antibody engineering, immunoglobulin G1, Fc fragment, glycosylations, CH3 domain, Fcab, VEGF, vascular endothelial growth factor
Deposited on 2016-05-24, released 2017-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (134-136)
      • engineered mutation (163-164)
      • insertion (164)
      • insertion (164)
      • insertion (164)
      • insertion (164)
      • insertion (164)
      • engineered mutation (193-196)
      • engineered mutation (198-199)
      • engineered mutation (201-202)
    Domains in SCOPe 2.06: d5k64a1, d5k64a2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (134-136)
      • engineered mutation (163-164)
      • insertion (164)
      • insertion (164)
      • insertion (164)
      • insertion (164)
      • insertion (164)
      • engineered mutation (193-196)
      • engineered mutation (198-199)
      • engineered mutation (201-202)
    Domains in SCOPe 2.06: d5k64b1, d5k64b2
  • Heterogens: NAG, BMA, MAN, GOL, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k64A (A:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdelrfyqvsltclvkgfypsdiavewesngqpdifpnglnykttppvld
    sdgsfflyskltvpypswlmgtrfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k64A (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    delrfyqvsltclvkgfypsdiavewesngqpdifpnglnykttppvldsdgsfflyskl
    tvpypswlmgtrfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k64B (B:)
    tcppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvev
    hnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpr
    epqvytlppsrdelrfyqvsltclvkgfypsdiavewesngqpdifpnglnykttppvld
    sdgsfflyskltvpypswlmgtrfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k64B (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    delrfyqvsltclvkgfypsdiavewesngqpdifpnglnykttppvldsdgsfflyskl
    tvpypswlmgtrfscsvmhealhnhytqkslsl