PDB entry 5k5z

View 5k5z on RCSB PDB site
Description: structure of pnob8 para
Deposited on 2016-05-24, released 2016-06-22
The last revision was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ParA
    Species: Sulfolobus sp. NOB8H2 [TaxId:84600]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ParA
    Species: Sulfolobus sp. NOB8H2 [TaxId:84600]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ParA
    Species: Sulfolobus sp. NOB8H2 [TaxId:84600]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: ParA
    Species: Sulfolobus sp. NOB8H2 [TaxId:84600]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k5zA (A:)
    iakvitihnfkggvgkttttaiiamglgamgkrvllidfdaqmsltqifvreedrlkile
    sshdvtqdksafallrtmeparikffhegkgvkfgidvipgsymsifklmfegyipiqse
    wnilrmldlyrdqydyilidtapsdtvtikpilrashyllipedgtpeaftamriflnea
    lpkyilprpeggfykyprilgviltrvrrnstailmkhnkileeelsnselkdhviyppy
    fgadkdnpedyilssrkeylsdliwrdekrapisevfdklflvddkvqkdlyaffskvft
    eipkevvrrvendq
    

    Sequence, based on observed residues (ATOM records):
    >5k5zA (A:)
    iakvitihnfkggvgkttttaiiamglgamgkrvllidfdaqmsltqifvreedrlkile
    sshvtqdksafallrtmeparikffhegkgvkfgidvipgsymsifklmfegyipiqsew
    nilrmldlyrdqydyilidtapsdtvtikpilrashyllipedgtpeaftamriflneal
    pkyilprpeggfykyprilgviltrvstailmkhnkileeelsnselkdhviyppyfgad
    kdnpedyilssrkeylsdliwrdekrapisevfdklflvddkvqkdlyaffskvfteipk
    evvrrvendq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k5zB (B:)
    iakvitihnfkggvgkttttaiiamglgamgkrvllidfdaqmsltqifvreedrlkile
    sshdvtqdksafallrtmeparikffhegkgvkfgidvipgsymsifklmfegyipiqse
    wnilrmldlyrdqydyilidtapsdtvtikpilrashyllipedgtpeaftamriflnea
    lpkyilprpeggfykyprilgviltrvrrnstailmkhnkileeelsnselkdhviyppy
    fgadkdnpedyilssrkeylsdliwrdekrapisevfdklflvddkvqkdlyaffskvft
    eipkevvrrvendq
    

    Sequence, based on observed residues (ATOM records):
    >5k5zB (B:)
    iakvitihnfkggvgkttttaiiamglgamgkrvllidfdaqmsltqifvreedrlkile
    sshqdksafallrtmeparikffhegkgvkfgidvipgsymsifklmfegyipiqsewni
    lrmldlyrdqydyilidtapsdtvtikpilrashyllipedgtpeaftamriflnealpk
    yilprpeggfykyprilgviltrvrstailmkhnkileeelsnselkdhviyppyfgadk
    dnpedyilssrkeylsdliwrdekrapisevfdklfkdlyaffskvfteipkevvrrven
    dq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5k5zC (C:)
    iakvitihnfkggvgkttttaiiamglgamgkrvllidfdaqmsltqifvreedrlkile
    sshdvtqdksafallrtmeparikffhegkgvkfgidvipgsymsifklmfegyipiqse
    wnilrmldlyrdqydyilidtapsdtvtikpilrashyllipedgtpeaftamriflnea
    lpkyilprpeggfykyprilgviltrvrrnstailmkhnkileeelsnselkdhviyppy
    fgadkdnpedyilssrkeylsdliwrdekrapisevfdklflvddkvqkdlyaffskvft
    eipkevvrrvendq
    

    Sequence, based on observed residues (ATOM records):
    >5k5zC (C:)
    iakvitihnfkggvgkttttaiiamglgamgkrvllidfdaqmsltqifvreedrlkile
    sshdvtqdksafallrtmeparikffhegkgvkfgidvipgsymsifklmfegyipiqse
    wnilrmldlyrdqydyilidtapsdtvtikpilrashyllipedgtpeaftamriflnea
    lpkyilprpeggfykyprilgviltrvrrnstailmkhnkileeelsnselkdhviyppy
    fgadkdnpedyilssrdliwrdekrapisevfdklfteipkevvrrvendq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >5k5zD (D:)
    iakvitihnfkggvgkttttaiiamglgamgkrvllidfdaqmsltqifvreedrlkile
    sshdvtqdksafallrtmeparikffhegkgvkfgidvipgsymsifklmfegyipiqse
    wnilrmldlyrdqydyilidtapsdtvtikpilrashyllipedgtpeaftamriflnea
    lpkyilprpeggfykyprilgviltrvrrnstailmkhnkileeelsnselkdhviyppy
    fgadkdnpedyilssrkeylsdliwrdekrapisevfdklflvddkvqkdlyaffskvft
    eipkevvrrvendq