PDB entry 5k5s

View 5k5s on RCSB PDB site
Description: crystal structure of the active form of human calcium-sensing receptor extracellular domain
Deposited on 2016-05-23, released 2016-08-03
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Extracellular calcium-sensing receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: CASR, GPRC2A, PCAR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41180 (19-End)
      • engineered mutation (401)
      • engineered mutation (467)
  • Chain 'B':
    Compound: Extracellular calcium-sensing receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: CASR, GPRC2A, PCAR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41180
      • engineered mutation (401)
      • engineered mutation (467)
  • Heterogens: TRP, PO4, CA, NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k5sA (A:)
    mafysccwvllaltwhtsaygpdqraqkkgdiilgglfpihfgvaakdqdlksrpesvec
    irynfrgfrwlqamifaieeinsspallpnltlgyrifdtcntvskaleatlsfvaqnki
    dslnldefcncsehipstiavvgatgsgvstavanllglfyipqvsyasssrllsnknqf
    ksflrtipndehqatamadiieyfrwnwvgtiaadddygrpgiekfreeaeerdicidfs
    elisqysdeeeiqhvveviqnstakvivvfssgpdleplikeivrrnitgkiwlaseawa
    sssliampqyfhvvggtigfalkagqipgfreflkkvhprksvhngfakefweetfnchl
    qegakgplpvdtflrgheesgdrfsqsstafrplctgdeninsvetpyidythlrisynv
    ylavysiahalqdiytclpgrglftngscadikkveawqvlkhlrhlqftnnmgeqvtfd
    ecgdlvgnysiinwhlspedgsivfkevgyynvyakkgerlfineekilwsgfsrevpfs
    ncsrdclagtrkgiiegeptccfecvecpdgeysdetdasacnkcpddfwsnenhtscia
    keieflsdykddddk
    

    Sequence, based on observed residues (ATOM records):
    >5k5sA (A:)
    ygpdqraqkkgdiilgglfpihfgvaakdqdlksrpesvecirynfrgfrwlqamifaie
    einsspallpnltlgyrifdtcntvskaleatlsfvaqnkipstiavvgatgsgvstava
    nllglfyipqvsyasssrllsnknqfksflrtipndehqatamadiieyfrwnwvgtiaa
    dddygrpgiekfreeaeerdicidfselisqysdeeeiqhvveviqnstakvivvfssgp
    dleplikeivrrnitgkiwlaseawasssliampqyfhvvggtigfalkagqipgfrefl
    kkvhprksvhngfakefweetfnchplctgdeninsvetpyidythlrisynvylavysi
    ahalqdiytclpgrglftngscadikkveawqvlkhlrhlqftnnmgeqvtfdecgdlvg
    nysiinwhlspedgsivfkevgyynvyakkgerlfineekilwsgfsrevpfsncsrdcl
    agtrkgiiegeptccfecvecpdgeysdetdasacnkcpddfwsnenhtsc
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k5sB (B:)
    mafysccwvllaltwhtsaygpdqraqkkgdiilgglfpihfgvaakdqdlksrpesvec
    irynfrgfrwlqamifaieeinsspallpnltlgyrifdtcntvskaleatlsfvaqnki
    dslnldefcncsehipstiavvgatgsgvstavanllglfyipqvsyasssrllsnknqf
    ksflrtipndehqatamadiieyfrwnwvgtiaadddygrpgiekfreeaeerdicidfs
    elisqysdeeeiqhvveviqnstakvivvfssgpdleplikeivrrnitgkiwlaseawa
    sssliampqyfhvvggtigfalkagqipgfreflkkvhprksvhngfakefweetfnchl
    qegakgplpvdtflrgheesgdrfsqsstafrplctgdeninsvetpyidythlrisynv
    ylavysiahalqdiytclpgrglftngscadikkveawqvlkhlrhlqftnnmgeqvtfd
    ecgdlvgnysiinwhlspedgsivfkevgyynvyakkgerlfineekilwsgfsrevpfs
    ncsrdclagtrkgiiegeptccfecvecpdgeysdetdasacnkcpddfwsnenhtscia
    keieflsdykddddk
    

    Sequence, based on observed residues (ATOM records):
    >5k5sB (B:)
    pdqraqkkgdiilgglfpihfgvaakdqdlksrpesvecirynfrgfrwlqamifaieei
    nsspallpnltlgyrifdtcntvskaleatlsfvaqnkidspstiavvgatgsgvstava
    nllglfyipqvsyasssrllsnknqfksflrtipndehqatamadiieyfrwnwvgtiaa
    dddygrpgiekfreeaeerdicidfselisqysdeeeiqhvveviqnstakvivvfssgp
    dleplikeivrrnitgkiwlaseawasssliampqyfhvvggtigfalkagqipgfrefl
    kkvhprksvhngfakefweetfnchlrplctgdeninsvetpyidythlrisynvylavy
    siahalqdiytclpgrglftngscadikkveawqvlkhlrhlqftnnmgeqvtfdecgdl
    vgnysiinwhlspedgsivfkevgyynvyakkgerlfineekilwsgfsrevpfsncsrd
    clagtrkgiiegeptccfecvecpdgeysdetdasacnkcpddfwsnenhtsciake