PDB entry 5k5d

View 5k5d on RCSB PDB site
Description: structure of the c2221 form of pnob8-like parb-n domain
Deposited on 2016-05-23, released 2016-06-15
The last revision was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ParB domain protein nuclease
    Species: Sulfolobus solfataricus [TaxId:555311]
    Gene: Ssol_1539
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0KSP7 (3-End)
      • engineered mutation (27)
      • engineered mutation (125)
      • engineered mutation (230)
      • engineered mutation (266)
  • Chain 'B':
    Compound: ParB domain protein nuclease
    Species: Sulfolobus solfataricus [TaxId:555311]
    Gene: Ssol_1539
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0KSP7 (3-End)
      • engineered mutation (27)
      • engineered mutation (125)
      • engineered mutation (230)
      • engineered mutation (266)
  • Chain 'C':
    Compound: ParB domain protein nuclease
    Species: Sulfolobus solfataricus [TaxId:555311]
    Gene: Ssol_1539
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0KSP7 (3-End)
      • engineered mutation (27)
      • engineered mutation (125)
      • engineered mutation (230)
      • engineered mutation (266)
  • Heterogens: CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k5dA (A:)
    gshmteltyteevvsieklkeddefktmvpsnnsredlekslreksqifpliadrnyvli
    dgytrldimkklgfkevkilkydfdsqqerdkayeliwtfngvrrqldknerlalfqkia
    driakmqasknkteeskivshatqfsateskqieeneefvtlddgttisaleyerilkel
    dkenkalsesdkrkmailrintpwllkyvtdqkykvpldqafriytrvkdmgildklkdl
    apalrdplittregrkiilndeyrdlmekiiskqytteraisvkqkealkrggkvkkssk
    

    Sequence, based on observed residues (ATOM records):
    >5k5dA (A:)
    mteltyteevvsieklkeddefktmvpsnnsredlekslreksqifpliadrnyvlidgy
    trldimkklgfkevkilkydfdsqqerdkayeliwtfngvrrqldknerlalfqkiadri
    akmqasknkteqieeneefvtlddgttisaleyerilkeldkenkalsesdkrkmailri
    ntpwllkyvtdqkykvpldqafriytrvkdmgildklkdlapalrdplittregrkiiln
    deyrdlmekiis
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k5dB (B:)
    gshmteltyteevvsieklkeddefktmvpsnnsredlekslreksqifpliadrnyvli
    dgytrldimkklgfkevkilkydfdsqqerdkayeliwtfngvrrqldknerlalfqkia
    driakmqasknkteeskivshatqfsateskqieeneefvtlddgttisaleyerilkel
    dkenkalsesdkrkmailrintpwllkyvtdqkykvpldqafriytrvkdmgildklkdl
    apalrdplittregrkiilndeyrdlmekiiskqytteraisvkqkealkrggkvkkssk
    

    Sequence, based on observed residues (ATOM records):
    >5k5dB (B:)
    mteltyteevvsieklkeddefktmvpsnnsredlekslreksqifpliadrnyvlidgy
    trldimkklgfkevkilkydfdsqqerdkayeliwtfngvrrqldknerlalfqkiadri
    akmqasknkteeeneefvtlddgttisaleyerilkeldkenkalsesdkrkmailrint
    pwllkyvtdqkykvpldqafriytrvkdmgildklkdlapalrdplittregrkiilnde
    yrdlmekiis
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >5k5dC (C:)
    gshmteltyteevvsieklkeddefktmvpsnnsredlekslreksqifpliadrnyvli
    dgytrldimkklgfkevkilkydfdsqqerdkayeliwtfngvrrqldknerlalfqkia
    driakmqasknkteeskivshatqfsateskqieeneefvtlddgttisaleyerilkel
    dkenkalsesdkrkmailrintpwllkyvtdqkykvpldqafriytrvkdmgildklkdl
    apalrdplittregrkiilndeyrdlmekiiskqytteraisvkqkealkrggkvkkssk
    

    Sequence, based on observed residues (ATOM records):
    >5k5dC (C:)
    mteltyteevvsieklkeddefktmvnnsredlekslreksqifpliadrnyvlidgytr
    ldimkklgfkevkilkydfdsqqerdkayeliwtfngvrrqldknerlalfqkiadriak
    mqasknkteieeneefvtlddgttisaleyerilkeldkenkalsesdkrkmailrintp
    wllkyvtdqkykvpldqafriytrvkdmgildklkdlapalrdplittregrkiilndey
    rdlmekiis