PDB entry 5k5b

View 5k5b on RCSB PDB site
Description: wild-type pas-gaf fragment from deinococcus radiodurans bphp
Deposited on 2016-05-23, released 2016-10-26
The last revision was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacteriophytochrome
    Species: Deinococcus radiodurans [TaxId:243230]
    Gene: bphP, DR_A0050
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RZA4 (Start-334)
      • expression tag (335)
  • Heterogens: ACT, MPD, LBV, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k5bA (A:)
    masmtggqqmgrgsmsrdplpffpplylggpeittencerepihipgsiqphgalltadg
    hsgevlqmslnaatflgqeptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwp
    aaghlsltvhrvgellilefepteawdstgphalrnamfalesapnlralaevatqtvre
    ltgfdrvmlykfapdatgeviaearreglhaflghrfpasdipaqaralytrhllrltad
    traaavpldpvlnpqtnaptplggavlratspmhmqylrnmgvgsslsvsvvvggqlwgl
    iachhqtpyvlppdlrttleylgrllslqvqvkealehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >5k5bA (A:)
    pffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflgqep
    tvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaghlsltvhrvgellilefe
    ptelrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreglh
    aflghrfpasdipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlrat
    spmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleylgrllslqv
    qvkeal