PDB entry 5k5a

View 5k5a on RCSB PDB site
Description: structure of the pnob8-like parb n-domain
Deposited on 2016-05-23, released 2016-06-15
The last revision was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.83 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: ParB domain protein nuclease
    Species: Sulfolobus solfataricus [TaxId:555311]
    Gene: Ssol_1539
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0KSP7 (3-End)
      • expression tag (0-2)
      • conflict (55)
      • conflict (107)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k5aB (B:)
    gshmteltyteevvsieklkeddefktlvpsnnsredlekslreksqifpliadrdyvli
    dgytrldimkklgfkevkilkydfdsqqerdkayeliwtfngvrrqlnknerlalfqkia
    driakiqasknkteeskivshatqfsateskqieeneefvtlddgttisaleyerilkel
    dkenkalsesdkrkmailrintpwllkyvtdqkykvpldqafriytrvkdlgildklkdl
    apalrdplittregrkiilndeyrdllekiiskqytteraisvkqkealkrggkvkkssk
    

    Sequence, based on observed residues (ATOM records):
    >5k5aB (B:)
    gshmteltyteevvsieklkeddefktlvpsnnsredlekslrekqifpliadrdyvlid
    gytrldimkklgfkevkilkydfdsqqerdkayeliwtfngvrrqlnknerlalfqkiad
    riakiqasknkteqieeneefvtlddgttisaleyerilkeldkenkalsesdkrkmail
    rintpwllkyvtdqkykvpldqafriytrvkdlgildklkdlapalrdplittregrkii
    lndeyrdllekiitteraisvkqkealk