PDB entry 5k58

View 5k58 on RCSB PDB site
Description: structure of the k. pneumonia slma-dna complex bound to the c-terminal of the cell division protein ftsz
Deposited on 2016-05-23, released 2016-06-22
The last revision was dated 2016-06-22, with a file datestamp of 2016-06-17.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoid occlusion factor SlmA
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: slmA, EcE24377A_4142
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7ZTJ2 (0-189)
      • engineered mutation (131)
  • Chain 'B':
    Compound: Nucleoid occlusion factor SlmA
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: slmA, EcE24377A_4142
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7ZTJ2 (Start-189)
      • engineered mutation (131)
  • Chain 'E':
    Compound: Nucleoid occlusion factor SlmA
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: slmA, EcE24377A_4142
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7ZTJ2 (0-189)
      • engineered mutation (131)
  • Chain 'F':
    Compound: Nucleoid occlusion factor SlmA
    Species: Escherichia coli O139:H28 (strain E24377A / ETEC) [TaxId:331111]
    Gene: slmA, EcE24377A_4142
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7ZTJ2 (Start-189)
      • engineered mutation (131)
  • Chain 'K':
    Compound: Octapeptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K58 (0-7)
  • Chain 'L':
    Compound: Octapeptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K58 (Start-5)
  • Chain 'M':
    Compound: Octapeptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K58 (0-7)
  • Chain 'N':
    Compound: Octapeptide
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K58 (Start-5)
  • Chain 'R':
    Compound: DNA (5'-d(*gp*tp*gp*ap*gp*tp*ap*cp*tp*cp*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'T':
    Compound: DNA (5'-d(*gp*tp*gp*ap*gp*tp*ap*cp*tp*cp*ap*c)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >5k58A (A:)
    rnrreeilqslalmlessdgsqrittaklaasvgvseaalyrhfpsktrmfdsliefied
    slitrinlilkdekdttarlrlivllllgfgernpgltriltghalmfeqdrlqgrinql
    ferieaqlrqvmrekrmregegyttdetllasqilafcegmlsrfvrsefkyrptddfda
    rwpliaaqlq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k58B (B:)
    rnrreeilqslalmlessdgsqrittaklaasvgvseaalyrhfpsktrmfdsliefied
    slitrinlilkdekdttarlrlivllllgfgernpgltriltghalmfeqdrlqgrinql
    ferieaqlrqvmrekrmregegyttdetllasqilafcegmlsrfvrsefkyrptddfda
    rwpliaaqlq
    

    Sequence, based on observed residues (ATOM records):
    >5k58B (B:)
    nrreeilqslalmlessdgsqrittaklaasvgvseaalyrhfpsktrmfdsliefieds
    litrinlilkdekdttarlrlivllllgfgernpgltriltghalmfeqdrlqgrinqlf
    erieaqlrqvmrekrmregegyttdetllasqilafcegmlsrfvrsefkyrptddfdar
    wpliaaqlq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >5k58E (E:)
    rnrreeilqslalmlessdgsqrittaklaasvgvseaalyrhfpsktrmfdsliefied
    slitrinlilkdekdttarlrlivllllgfgernpgltriltghalmfeqdrlqgrinql
    ferieaqlrqvmrekrmregegyttdetllasqilafcegmlsrfvrsefkyrptddfda
    rwpliaaqlq
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >5k58F (F:)
    rnrreeilqslalmlessdgsqrittaklaasvgvseaalyrhfpsktrmfdsliefied
    slitrinlilkdekdttarlrlivllllgfgernpgltriltghalmfeqdrlqgrinql
    ferieaqlrqvmrekrmregegyttdetllasqilafcegmlsrfvrsefkyrptddfda
    rwpliaaqlq
    

    Sequence, based on observed residues (ATOM records):
    >5k58F (F:)
    nrreeilqslalmlessdgsqrittaklaasvgvseaalyrhfpsktrmfdsliefieds
    litrinlilkdekdttarlrlivllllgfgernpgltriltghalmfeqdrlqgrinqlf
    erieaqlrqvmrekrmregegyttdetllasqilafcegmlsrfvrsefkyrptddfdar
    wpliaaqlq
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records:
    >5k58K (K:)
    ldipaflr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records:
    >5k58L (L:)
    ldipaflr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records:
    >5k58M (M:)
    ldipaflr
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records:
    >5k58N (N:)
    ldipaflr
    

  • Chain 'R':
    No sequence available.

  • Chain 'T':
    No sequence available.