PDB entry 5k50

View 5k50 on RCSB PDB site
Description: Three-dimensional structure of L-threonine 3-dehydrogenase from Trypanosoma brucei bound to NAD+ and L-allo-threonine refined to 2.23 angstroms
Class: oxidoreductase
Keywords: Short-chain dehydrogenase, threonine, holo, ligand-bound, oxidoreductase
Deposited on 2016-05-22, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k50a_
  • Chain 'C':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k50c_
  • Chain 'E':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k50e_
  • Chain 'G':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k50g_
  • Chain 'I':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k50i_
  • Chain 'J':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k50j_
  • Heterogens: NAD, GOL, ACT, ALO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k50A (A:)
    prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
    eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
    fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
    ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
    tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
    mmsedmlrqipilhglpsl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k50C (C:)
    prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
    eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
    fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
    ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
    tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
    mmsedmlrqipilhglpsl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k50E (E:)
    prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
    eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
    fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
    ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
    tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
    mmsedmlrqipilhglpsl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k50G (G:)
    prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
    eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
    fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
    ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
    tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
    mmsedmlrqipilhglpsl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k50I (I:)
    prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
    eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
    fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
    ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
    tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
    mmsedmlrqipilhglpsl
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k50J (J:)
    prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
    eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
    fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
    ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
    tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
    mmsedmlrqipilhglpsl