PDB entry 5k4z

View 5k4z on RCSB PDB site
Description: M. thermoresistible IMPDH in complex with IMP and Compound 6
Class: oxidoreductase
Keywords: IMPDH, GuaB2, inhibitor-complex, oxidoreductase
Deposited on 2016-05-22, released 2016-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase
    Species: Mycobacterium thermoresistibile [TaxId:1797]
    Gene: RMCT_0580
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k4za_
  • Heterogens: IMP, 6Q8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k4zA (A:)
    gssiaersvpiavpvptggddptkiamlgltfddvlllpaasdvlpanadtssqltkkir
    lkvplvssamdtvtearmaiamaraggmgvlhrnlpvaeqaaqvetvkrsggllvgaavg
    vgddaweramalrdagvdvlvvdtahahnrkvldmvhrlkttvgdeievvggnvatraaa
    aalveagadavkvgvgpgsicttrvvagvgapqitaileavaacaphgvpviadgglqys
    gdiakalaagastamlgsllagtaespgelilvngkqfksyrgmgslgamqgrggaksys
    kdryfqddalsedklvpegiegrvpfrgplstvihqlvgglraamgytgsatieelqqaq
    fvqitaaglkeshphditmtveapnyyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k4zA (A:)
    vptggddptkiamlgltfddvlllpaasdvlpanadtssqltkkirlkvplvssamdtvt
    earmaiamaraggmgvlhrnlpvaeqaaqvetvkrsggllvgaavgvgddaweramalrd
    agvdvlvvdtahahnrkvldmvhrlkttvgdeievvggnvatraaaaalveagadavkvg
    vgpgsicttrvvagvgapqitaileavaacaphgvpviadgglqysgdiakalaagasta
    mlgsllagtaespgelilvngkqfksyrgmgslgamqlvpegiegrvpfrgplstvihql
    vgglraamgytgsatieelqqaqfvqitaagl