PDB entry 5k4u

View 5k4u on RCSB PDB site
Description: Three-dimensional structure of L-threonine 3-dehydrogenase from Trypanosoma brucei showing different active site loop conformations between dimer subunits, refined to 1.9 angstroms
Class: oxidoreductase
Keywords: short-chain dehydrogenase, ligand-bound, holo, oxidoreductase
Deposited on 2016-05-22, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7YW97 (1-319)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5k4ua1, d5k4ua2
  • Chain 'C':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7YW97 (1-319)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5k4uc1, d5k4uc2
  • Heterogens: NAD, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k4uA (A:)
    mprvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsng
    feklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstia
    afgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlp
    gggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyn
    itgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydi
    dmmsedmlrqipilhglpsl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k4uC (C:)
    mprvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsng
    feklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstia
    afgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlp
    gggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyn
    itgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydi
    dmmsedmlrqipilhglpsl