PDB entry 5k4t

View 5k4t on RCSB PDB site
Description: Three-dimensional structure of L-threonine 3-dehydrogenase from Trypanosoma brucei refined to 2.1 angstroms
Class: oxidoreductase
Keywords: short-chain dehydrogenase, ligand-bound, apo, oxidoreuctase, OXIDOREDUCTASE
Deposited on 2016-05-22, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7YW97 (2-320)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5k4ta1, d5k4ta2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k4tA (A:)
    hmprvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsn
    gfeklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipsti
    aafgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatl
    pgggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvy
    nitgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkyd
    idmmsedmlrqipilhglpsl