PDB entry 5k4q

View 5k4q on RCSB PDB site
Description: Three-dimensional structure of L-threonine 3-dehydrogenase from Trypanosoma brucei bound to NAD+ refined to 2.3 angstroms
Class: oxidoreductase
Keywords: short-chain dehydrogenase, ligand-bound, holo, oxidoreductase
Deposited on 2016-05-21, released 2017-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7YW97
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5k4qa1, d5k4qa2
  • Chain 'B':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k4qb_
  • Chain 'C':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k4qc_
  • Chain 'D':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7YW97
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5k4qd1, d5k4qd2
  • Chain 'E':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k4qe_
  • Chain 'F':
    Compound: L-threonine 3-dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k4qf_
  • Heterogens: NAD, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k4qA (A:)
    mprvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsng
    feklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstia
    afgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlp
    gggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyn
    itgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydi
    dmmsedmlrqipilhglpsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k4qB (B:)
    mprvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsng
    feklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstia
    afgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlp
    gggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyn
    itgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydi
    dmmsedmlrqipilhglpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k4qB (B:)
    prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
    eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
    fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
    ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
    tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
    mmsedmlrqipilhglpsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5k4qC (C:)
    mprvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsng
    feklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstia
    afgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlp
    gggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyn
    itgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydi
    dmmsedmlrqipilhglpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k4qC (C:)
    prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
    eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
    fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
    ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
    tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
    mmsedmlrqipilhglpsl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k4qD (D:)
    mprvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsng
    feklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstia
    afgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlp
    gggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyn
    itgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydi
    dmmsedmlrqipilhglpsl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5k4qE (E:)
    mprvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsng
    feklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstia
    afgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlp
    gggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyn
    itgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydi
    dmmsedmlrqipilhglpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k4qE (E:)
    prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
    eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
    fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
    ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
    tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
    mmsedmlrqipilhglpsl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5k4qF (F:)
    mprvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsng
    feklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstia
    afgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlp
    gggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyn
    itgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydi
    dmmsedmlrqipilhglpsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k4qF (F:)
    prvlvtgalgqigtdlslalrdkfgadsvlvsdvvepgakhplaglkgvekldcldsngf
    eklvkefkptwmyhlpaimsvrgeaepdlamdinvnttryalelarkynirifipstiaa
    fgdkcgktmtkddtimnpstvygvtkvytellgtwyrqkygvdfrsvrlpgiisaatlpg
    ggatdyaihmyhsallqkkcvcpvlpyeslpmmympdtlnslvkimeaplekltrtvyni
    tgfsfspselrfsierctdrtieveyvegpaqkianswpdslddsnarndwghqvkydid
    mmsedmlrqipilhglpsl