PDB entry 5k4d

View 5k4d on RCSB PDB site
Description: structure of eukaryotic translation initiation factor 3 subunit d (eif3d) cap binding domain from nasonia vitripennis, crystal form 3
Deposited on 2016-05-20, released 2016-07-27
The last revision was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 3 subunit D
    Species: Nasonia vitripennis [TaxId:7425]
    Gene: LOC100122367
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Eukaryotic translation initiation factor 3 subunit D
    Species: Nasonia vitripennis [TaxId:7425]
    Gene: LOC100122367
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >5k4dA (A:)
    gssvtvrpdwvtieemdfprlskltlpgvkegedvlccgaveyydksydrvnvknekplq
    ridrifhtvtttddpvirklsktegnvyatdailatimcctrsnyswdiviekignklff
    dkrdntefdlltvnetsveppqddgnslnsprnlaleatfinhnfsqqvlksneprykfd
    epnpfiseeeegevasvayryrkwdlnngitliarcehdavmqgpnnetqfltikalnew
    dsklangvewrrkldtqrgavlanelrnnacklakwtvqallagsdqlkfgyvsrasvrd
    sskhviletqqykpnefatqinlnmdnawgilrciidicmnqkdgkylimkdpnkpmirl
    ydipdntf
    

    Sequence, based on observed residues (ATOM records):
    >5k4dA (A:)
    svtvrpdwvtieemdfprlskltlpgvkegedvlccgaveyydksydrvnvknekplqri
    drifhtvtttddpvirklsktegnvyatdailatimcctrsnyswdiviekignklffdk
    rdntefdlltvnetsveppqddgnslnsprnlaleatfinhnfsqqvlksneprykfdep
    npfigevasvayryrkwdlnngitliarcehdavmqgtqfltikalnewdsklangvewr
    rkldtqrgavlanelrnnacklakwtvqallagsdqlkfgyvsrasvrdsskhviletqq
    ykpnefatqinlnmdnawgilrciidicmnqkdgkylimkdpnkpmirlydipdnt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >5k4dB (B:)
    gssvtvrpdwvtieemdfprlskltlpgvkegedvlccgaveyydksydrvnvknekplq
    ridrifhtvtttddpvirklsktegnvyatdailatimcctrsnyswdiviekignklff
    dkrdntefdlltvnetsveppqddgnslnsprnlaleatfinhnfsqqvlksneprykfd
    epnpfiseeeegevasvayryrkwdlnngitliarcehdavmqgpnnetqfltikalnew
    dsklangvewrrkldtqrgavlanelrnnacklakwtvqallagsdqlkfgyvsrasvrd
    sskhviletqqykpnefatqinlnmdnawgilrciidicmnqkdgkylimkdpnkpmirl
    ydipdntf
    

    Sequence, based on observed residues (ATOM records):
    >5k4dB (B:)
    dwvtieemdfprlskltlpgvkegedvlccgaveyydksydrvnvknekplqridrifht
    vtttddpvirklsktegnvyatdailatimcctrsnyswdiviekignklffdkrtefdl
    ltvnetsveppqddgnslnsprnlaleatfinhnfsqqvlksneprykfdepnpfievas
    vayryrkwdlnngitliarcehdavmqgpnnetqfltikalnewdsklangvewrrkldt
    qrgavlanelrnnacklakwtvqallagsdqlkfgyvsrasvrdsskhviletqqykpne
    fatqinlnmdnawgilrciidicmnqkdgkylimkdpnkpmirlydipd