PDB entry 5k44

View 5k44 on RCSB PDB site
Description: Structure of Mycobacterium thermoresistibile trehalose-6-phosphate synthase in a complex with Trehalose-6-phosphate.
Class: transferase
Keywords: OtsA trehalose-6-phosphate synthase, Trehalose, transferase
Deposited on 2016-05-20, released 2017-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha,alpha-trehalose-phosphate synthase
    Species: Mycobacterium thermoresistibile [TaxId:1797]
    Gene: RMCT_1906
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5k44a_
  • Heterogens: NHE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k44A (A:)
    smadrgdsgdsdfvvvanrlpidlerapdgttswkrspgglvtalepllrrrrgawigwp
    gipdsdedpivdgdlvlypvrlsaddvaqyyegfsnatlwplyhdvivkpiynrqwwery
    vevnrrfaeatsraaargatvwvqdyqlqlvpkmlrelrpdltigfflhipfppvelfmq
    lpwrteitdgllgadlvgfhlpggaqnflflarrlvgantsrasvgvrskfgevqigsrt
    vkvgafpisidsadldrqarqrsirqrarqiraelgnprrillgvdrldytkgidvrlqa
    faellaegrvnredtvfvqlatpsrerveayrllrddierqvghingeygevghpvvhyl
    hrpvpreeliaffvaadvmlvtplrdgmnlvakeyvacrsdlggalvlseftgaaaelgq
    aylvnphnldhvkdtmvaalnqtpeegrrrmralrrqvlahdvdlwarsfldalastrtg
    dadavpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k44A (A:)
    gdsdfvvvanrlpidwkrspgglvtalepllrrrrgawigwpgipdsdedpivdgdlvly
    pvrlsaddvaqyyegfsnatlwplyhdvivkpiynrqwweryvevnrrfaeatsraaarg
    atvwvqdyqlqlvpkmlrelrpdltigfflhipfppvelfmqlpwrteitdgllgadlvg
    fhlpggaqnflflarrlvgantsrasvgvrskfgevqigsrtvkvgafpisidsadldrq
    arqrsirqrarqiraelgnprrillgvdrldytkgidvrlqafaellaegrvnredtvfv
    qlatpsrerveayrllrddierqvghingeygevghpvvhylhrpvpreeliaffvaadv
    mlvtplrdgmnlvakeyvacrsdlggalvlseftgaaaelgqaylvnphnldhvkdtmva
    alnqtpeegrrrmralrrqvlahdvdlwarsfldalastr